powered by:
Protein Alignment Kua and ben
DIOPT Version :8
Sequence 1: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001162752.1 |
Gene: | ben / 32358 |
FlyBaseID: | FBgn0000173 |
Length: | 151 |
Species: | Drosophila melanogaster |
Alignment Length: | 35 |
Identity: | 10/35 - (28%) |
Similarity: | 14/35 - (40%) |
Gaps: | 3/35 - (8%) |
Fly 45 GTKATSPPNSAT---LVSTSPRWGPQNKGAQELAL 76
|..|....|:|. ::.|.|...|...|..:|.|
Fly 22 GINAIPDENNARYFHVIVTGPNDSPFEGGVFKLEL 56
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
Kua | NP_001188856.1 |
TMEM189_B_dmain |
124..301 |
CDD:287490 |
|
ben | NP_001162752.1 |
UBCc |
3..149 |
CDD:320784 |
10/35 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
|
|
|
C124449935 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.