DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Aifm1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_112646.1 Gene:Aifm1 RGDID:620817 Length:612 Species:Rattus norvegicus

Alignment Length:457 Identity:93/458 (20%)
Similarity:169/458 (37%) Gaps:137/458 (30%)


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTES----------------SIVKSVTNLVPVARYLH 55
            ||::|||.|..:.|.|:....|.|.:|:::|.                |...:||..:...::..
  Rat   133 FLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNG 197

  Fly    56 K----------FDVREQDVS--EMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGT 108
            |          |.|..||:.  |.|........::.|::.|.:.::...|.:|.:....:.||||
  Rat   198 KERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGT 262

  Fly   109 PKLFS-----GKVVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVV 168
            |:..|     |..|.......|.....:.|::.....|.:.::|.|.:.||||            
  Rat   263 PRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELA------------ 315

  Fly   169 KDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAI--KRMRYSEVLPK-------EQTNNHGAA 224
                               .|:...:......|:.:  ::....::||:       |:....|..
  Rat   316 -------------------CALGRKSQASGIEVIQLFPEKGNMGKILPEYLSNWTMEKVKREGVK 361

  Fly   225 LGPD-WHRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVS 288
            :.|: ..:||.:||.:                           .::||  :||  :::..|.||:
  Rat   362 VMPNAIVQSVGVSGGK---------------------------LLIKL--KDG--RKVETDHIVT 395

  Fly   289 ATGVWPNTDYTCDSPLQF-SDDGGISVDEMM--RTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQ 350
            |.|:.||.:......|:. ||.||..|:..:  |:|   ::.|||        |..::.::|..:
  Rat   396 AVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD--------AACFYDIKLGRR 449

  Fly   351 -------ARQMGSMAGRSMAAASE---GESVY-----QDFCFELFGHVTKLFGYPVV-LLGRFNG 399
                   |...|.:||.:|..|::   .:|::     .|..:|..|.|..  ..|.| :..:...
  Rat   450 RVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDS--SLPTVGVFAKATA 512

  Fly   400 QD 401
            ||
  Rat   513 QD 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 78/400 (20%)
Aifm1NP_112646.1 FAD-dependent oxidoreductase. {ECO:0000250} 133..482 85/422 (20%)
Pyr_redox_2 149..446 CDD:285266 69/370 (19%)
Pyr_redox 301..385 CDD:278498 20/144 (14%)
Nuclear localization signal. {ECO:0000255} 445..450 1/5 (20%)
AIF_C 464..592 CDD:291391 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.