DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and AT3G44190

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_190005.1 Gene:AT3G44190 AraportID:AT3G44190 Length:367 Species:Arabidopsis thaliana

Alignment Length:419 Identity:89/420 (21%)
Similarity:149/420 (35%) Gaps:139/420 (33%)


  Fly     8 LVVGGGIAGVSCAE------SLAIYRPN-------ASILLLTESSIV-KSVTNLVPVARYLHKFD 58
            :|:||||||...::      .|.:..|.       ||:..:.|.:.. :||.|        ||..
plant    15 IVIGGGIAGSLASKFLQFDSDLTLIDPKEYFEIIWASLRSMVEPAFAERSVIN--------HKKY 71

  Fly    59 VREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGT---PKLFSGKVVNPL 120
            ::...|....|           :|..:..:.|..||...|.||.:.||..   ||....|:    
plant    72 LQNGRVVTSPA-----------VNITDTDVLTADGLVFGYDYLVIATGHNDVLPKTRQEKL---- 121

  Fly   121 VIGIRDTDSVQLLQRKLATAKDVLILGNG----GIASELAYELKDVNVHWVVKDSHISATFVDPG 181
                   ...|....|:.:::.:||:|.|    .:|:|:|.:..:..| .:|.:......||...
plant   122 -------SQYQTEHEKIKSSESILIVGGGPSGVELAAEIAVDFPEKKV-TIVHNGPRLLEFVGQK 178

  Fly   182 AAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRL 246
            ||:         .|.|     .:|..|...:|                ::.||||.|.:|.    
plant   179 AAD---------KALD-----WMKSKRVEVIL----------------NQRVDLSSASDGS---- 209

  Fly   247 PKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDD-- 309
             |.|..|...::              |.|       |.|:  .||...::::...:.|:.:.|  
plant   210 -KTYRTSGGETI--------------HAD-------CHFL--CTGKPLSSEWLKGTVLKDNLDGK 250

  Fly   310 GGISVDEMMRT-NLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSMAAASEGESVYQ 373
            |.:.|||.:|. ...:|||.||:....        :|:....|.:..|:|.:::.....|     
plant   251 GRLMVDEYLRVKGRKNVFAIGDITDVP--------EMKQGYIAEKHASVATKNIKLLMSG----- 302

  Fly   374 DFCFELFGHVTKLFGY------PVVLLGR 396
                   |:..|:..|      .::.|||
plant   303 -------GNEKKMSTYKPGPDIAIISLGR 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 80/371 (22%)
AT3G44190NP_190005.1 NAD_binding_7 10..>47 CDD:289982 9/32 (28%)
Ndh 12..346 CDD:224172 89/420 (21%)
NADB_Rossmann <76..109 CDD:304358 11/44 (25%)
Pyr_redox 136..217 CDD:278498 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463391at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.