DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Aifm3

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_006522653.1 Gene:Aifm3 MGIID:1919418 Length:610 Species:Mus musculus

Alignment Length:464 Identity:101/465 (22%)
Similarity:165/465 (35%) Gaps:133/465 (29%)


  Fly     2 SRKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPV--ARYLHKFDVREQDV 64
            |.....|:||.|.||:.|||:|.....:..|:|.|       :...:|.  |:.....|.:.:.:
Mouse   192 SSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCT-------LDRHLPYDRAKLSKSLDAQPEQL 249

  Fly    65 S------------EMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFS--GK 115
            :            ||....|.:.     ::.|...:..|.|.:::|..|.|..|.:||..:  ||
Mouse   250 ALRPKEFFRAYGIEMLTEAQVVT-----VDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLTCKGK 309

  Fly   116 VVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDP 180
            .|.. |..||..:....:.| ||..::.:::|.|.:..|:|        .::.:.:|        
Mouse   310 DVEN-VFTIRTPEDANRVLR-LARGRNAVVVGAGFLGMEVA--------AYLTEKAH-------- 356

  Fly   181 GAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGE--- 242
                             |..||.::...:...|                       |.|.|.   
Mouse   357 -----------------SVSVVELEETPFRRFL-----------------------GERVGRALM 381

  Fly   243 ---ENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQ--------LTCDFIVSATGVWPNT 296
               ||...|.|.::.:|             :|..::|..|:        |..|..|...|..|.|
Mouse   382 KMFENNRVKFYMQTEVS-------------ELRAQEGKLQEVVLKSSKVLRADVCVLGIGAVPAT 433

  Fly   297 DYTCDSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRL-----WTQARQMGS 356
            .:...|.:.....|.|.|::||:||:..||||||..|  :|.|  |...|.     |..|...|.
Mouse   434 GFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVT--FPLA--WRNNRKVNIPHWQMAHAQGR 494

  Fly   357 MAGRSMAAASEGESVYQDFCFELFGHVTKLFGY-----PVVLLGRFNGQDLGRDYEILVRCTRNK 416
            :|.::|.|.....:........:||...:..||     .|::.|     || .:.:.:...|::.
Mouse   495 VAAQNMLAQEAEINTVPYLWTAMFGKSLRYAGYGEGFDDVIIQG-----DL-EELKFVAFYTKSD 553

  Fly   417 EYIKFVLQN 425
            |.|.....|
Mouse   554 EVIAVASMN 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 84/382 (22%)
Aifm3XP_006522653.1 Rieske_AIFL_N 70..163 CDD:239560
Pyr_redox_2 195..493 CDD:285266 84/385 (22%)
NADB_Rossmann 196..285 CDD:304358 21/101 (21%)
Pyr_redox 334..414 CDD:278498 20/149 (13%)
Reductase_C 512..>562 CDD:291425 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.