DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Aifm2

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_722474.2 Gene:Aifm2 MGIID:1918611 Length:380 Species:Mus musculus

Alignment Length:434 Identity:78/435 (18%)
Similarity:149/435 (34%) Gaps:139/435 (32%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGASFQ 72
            ::||||..|::.|..|........::.:.:|              :.|........| |.|.:.:
Mouse    15 VIVGGGFGGIAAASQLQALNVPFMLVDMKDS--------------FHHNVAALRASV-ESGFAKK 64

  Fly    73 TLVD------------RLDHINSREHCIRTKAGLEIKYRYLCLCTGGT---PKLFSGKVVNPLVI 122
            |.:.            ::..|:.:...:..:.|..:.:.:|.|.||.|   |..|:........|
Mouse    65 TFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAI 129

  Fly   123 GIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFH 187
            ...: |.|:.:||    ::.::::|.|....|:|.|:|.......|...|......|        
Mouse   130 QAYE-DMVKQIQR----SQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLAD-------- 181

  Fly   188 IAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYK 252
                    |:..|.|   |....|:|                        .|:|.:     :...
Mouse   182 --------KELLPCV---RQEVKEIL------------------------LRKGVQ-----LLLS 206

  Fly   253 SRISSVQDL-ADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTD-YTCDSPLQFSDDGGISVD 315
            .|:|::::| .::....:|:|.:.|:  ::..:.::...|:..|:. |......:.:.:|.:.|:
Mouse   207 ERVSNLEELPRNEYREYIKVETDKGT--EVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVN 269

  Fly   316 EMMRT-NLVDVFAAGD------------------VCTANW-------------------PAAMHW 342
            |.::. ...:::|.||                  |..||.                   |||:. 
Mouse   270 EFLQVEGYSNIYAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPETDQPPAALS- 333

  Fly   343 FQMRLWTQARQMGSMAGRSMAAASEGESVYQDFCFELFGHVTKL 386
            ..:.|||.||::         ..|||...|    .:..|||..|
Mouse   334 PALLLWTPARKL---------TLSEGRINY----LQEAGHVRTL 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 70/402 (17%)
Aifm2NP_722474.2 Pyr_redox_2 20..302 CDD:285266 56/352 (16%)
TIM_phosphate_binding <268..364 CDD:304361 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.