DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Sqor

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001155975.1 Gene:Sqor MGIID:1929899 Length:450 Species:Mus musculus

Alignment Length:468 Identity:96/469 (20%)
Similarity:171/469 (36%) Gaps:122/469 (26%)


  Fly     6 EFLVVGGGIAGVSC---------AESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVRE 61
            |.||:|||..|::.         ||::||..|       :|....:.:..||..........|| 
Mouse    45 EVLVLGGGAGGITMATRMKRRVGAENVAIVEP-------SERHFYQPIWTLVGAGAKELSLSVR- 101

  Fly    62 QDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTG---------GTPKLFSGKVV 117
            ..:|.:.:..|.:.||:..:|..|:||||.:|.||.||||.:..|         |.|:.|:    
Mouse   102 STLSVIPSGVQWIQDRVAELNPDENCIRTDSGKEISYRYLIIALGIQLDYEKIKGLPEGFA---- 162

  Fly   118 NPLVIGIRDTDSVQLLQRKLATAKDVLILGN------------GGIASELAYELKDVNVHWVVKD 170
            .|.:.......:|:...:.|...|:    ||            .|...::.|          :.:
Mouse   163 YPKIGSNYSVKTVEKTWKALQGFKE----GNALFTFPNTPVKCAGAPQKIMY----------LSE 213

  Fly   171 SHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDL 235
            ::...|...|.|...|:.|:        ..:..:|  :|::.|             .:..|..|:
Mouse   214 AYFRKTGKRPKANIIFNTAL--------GTIFGVK--KYADAL-------------QEIIRERDV 255

  Fly   236 SGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTC 300
            |            :.||..:..|:  .|...|:.::..:.|....:..: ::..|......|...
Mouse   256 S------------VNYKHNLIEVR--PDKQEAVFEILDKPGETHVIPYE-MLHVTPPMSAPDVLK 305

  Fly   301 DSPLQFSDDGG-ISVDE--MMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAG--- 359
            .||:  :|..| :.||:  :......:||..|| || |.|.:         ..|..:.:.:|   
Mouse   306 RSPV--ADSAGWVDVDKETLQHKKYPNVFGIGD-CT-NLPTS---------KTAAAVAAQSGILD 357

  Fly   360 RSMAAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFN--GQDL-----GRDYEILVRCTRNKE 417
            |:|....:.:...:.  ::.:.....:.||..|:|..|:  .|.|     .:..|.:.......:
Mouse   358 RTMCLIMKNQRPIKK--YDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERITMYLMKAD 420

  Fly   418 YIKFVLQNGRLRG 430
            .:.|:..|..|||
Mouse   421 MMPFLYWNMMLRG 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 79/380 (21%)
SqorNP_001155975.1 Pyr_redox_2 64..354 CDD:285266 73/367 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.