DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm2

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001186939.1 Gene:aifm2 ZFINID:ZDB-GENE-050506-76 Length:373 Species:Danio rerio

Alignment Length:467 Identity:93/468 (20%)
Similarity:166/468 (35%) Gaps:161/468 (34%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGASFQ 72
            ::||||..|::.|:.|..|.                    ||. ..:...|....:|:.:.||.|
Zfish    14 VIVGGGFGGIAAAQHLKHYG--------------------VPF-MLIDVLDAFHHNVAALRASVQ 57

  Fly    73 T------------------LVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNP 119
            |                  |..|:..|::....:....|.|::|.:|.||||.|...       |
Zfish    58 TGFARKTFIPYKETFGLNFLQGRVIRIDTETQTVVLDNGKEVRYSHLILCTGTTGSF-------P 115

  Fly   120 LVIGIRDT--DSVQLLQ---RKLATAKDVLILGNGGIASELAYELK----DVNVHWVVKDSHISA 175
            ......||  .::|..:   ..:..|..::::|.|....|:|.|:|    |..|..:    |...
Zfish   116 SKHNSVDTYKSAIQKYEDFFHVIKEANAIVVVGGGTTGVEMAAEIKTEFHDKKVVLI----HPRE 176

  Fly   176 TFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLP--KEQTNNHGAALGPDWHRSVDLSGA 238
            ...||                              |:||  |||.            :.|.|   
Zfish   177 EVADP------------------------------ELLPCVKEQA------------KQVLL--- 196

  Fly   239 REGEENRLPKIYYKSRISSVQDLADD---AGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTD-YT 299
            .:|.|     :....::|::::|..:   :|.:||....    :|:|.|.::..||...|:: |.
Zfish   197 EKGVE-----LLLGQKVSNLEELELNVCRSGMVVKTNKN----EQVTTDLVICCTGSKINSEAYR 252

  Fly   300 CDSPLQFSDDGGISVDEMMRTNLVD-VFAAGDVCTANWPAAMHWFQMRLWTQARQ-MGSMAGRSM 362
            .......:::|.:.|::.::....| |:|.||....:.|...:...:.....|.. :.|::|:::
Zfish   253 SSMSSCLAENGALKVNKHLQVEGFDNVYAVGDCANLSEPKMAYHAGLHAGVAATNIINSLSGKAL 317

  Fly   363 AAASEGESVYQDFCFELFGHVTKLF------GYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKF 421
            .:       |:.      |:||.|.      |     :|:|||..|.|                |
Zfish   318 TS-------YKT------GNVTMLIAMGKDAG-----VGQFNGYKLPR----------------F 348

  Fly   422 VLQNGRLRGAML 433
            ::..|:..|.:|
Zfish   349 LVTKGKSEGLLL 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 75/382 (20%)
aifm2NP_001186939.1 Pyr_redox_2 19..301 CDD:285266 71/368 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.