DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm5

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_001920911.2 Gene:aifm5 ZFINID:ZDB-GENE-091118-96 Length:543 Species:Danio rerio

Alignment Length:472 Identity:89/473 (19%)
Similarity:166/473 (35%) Gaps:128/473 (27%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTE-----------SSIVKSVTNLVPVAR--YLHKFDV 59
            :::|||.|.:.|||:|........|::::.           |.::.:.::.:.:.|  :.||.|:
Zfish   143 MLLGGGAACLMCAETLRQENYGGRIIMVSRDDLLPYDKTRLSKVMNAESDSLLMRRMDFFHKHDI 207

  Fly    60 REQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGI 124
                  |:....:.|     .|::.:..:....||...|..:.:.||...|.......|...:.:
Zfish   208 ------EVWLKKEAL-----SIDTNKKTVTFDDGLIQSYDQILIATGCRAKGLDCPGANLERVLM 261

  Fly   125 RDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIA 189
            .:|...........|....:|:|...|..|:|..|.|.:                          
Zfish   262 LETPEDARCVHYACTGCRTVIVGTSFIGMEVAAYLLDTS-------------------------- 300

  Fly   190 MNECNAKDSSPVVAIKRMRYSEVLPKE---QTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYY 251
                   .|..|:....:.|.:.|.:|   .|.......|..::.: |.....:|:..|:..:..
Zfish   301 -------SSMTVIGSSELPYQKTLGREIGKVTMTMLEEKGVTFYMN-DAVAEVQGKNRRVKAVKL 357

  Fly   252 KSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDE 316
            ||.|:                        :..|.::.|.||.||:::...|.::......:.|||
Zfish   358 KSGIT------------------------IEADLLIVAIGVSPNSEFLKGSRVRMDSKNYVIVDE 398

  Fly   317 MMRTNLVDVFAAGDVCTANWPAAMHWFQ---MRLWTQARQMGSMAGRSMAAASEGESVYQDFCFE 378
            .||||:.||:.|||:  .::|..|...|   :..|..|:..|.:|..:|.......:....:...
Zfish   399 YMRTNITDVYCAGDL--TSFPLKMAKGQKVSLGHWQIAQAHGRIAALNMLCREVELNTVPYYWTV 461

  Fly   379 LFGHVTKLFGY-----PVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGRLRGAMLIGNTD 438
            |||...:..||     .:||.|:|                .|.:::...|::|.:..|.      
Zfish   462 LFGRTIRYAGYGEGYTEMVLKGKF----------------ENMKFLALYLKDGEVVAAA------ 504

  Fly   439 LAETCENLILNGIDLEP 455
                       |:::||
Zfish   505 -----------GLNVEP 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 70/366 (19%)
aifm5XP_001920911.2 Rieske_AIFL_N 21..114 CDD:239560
Pyr_redox_2 140..438 CDD:285266 70/366 (19%)
Pyr_redox 279..360 CDD:278498 19/115 (17%)
Reductase_C 457..535 CDD:291425 16/88 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.