DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and sqor

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_005163218.1 Gene:sqor / 550580 ZFINID:ZDB-GENE-050417-436 Length:483 Species:Danio rerio


Alignment Length:331 Identity:68/331 - (20%)
Similarity:110/331 - (33%) Gaps:94/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AKD---VLIL--GNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKDSS 199
            |||   ||:|  |:||||  :|..||.       |....:...|:|....::........|...|
Zfish    72 AKDHYKVLVLGGGSGGIA--MAARLKR-------KVGAENVAIVEPSEMHYYQPIWTLVGAGAKS 127

  Fly   200 PVVAIKRMRYSEVLPK--------------EQTNNHG------------AALGPDWHRSVDLSGA 238
              ||......|.|:|.              |:...|.            .|||.:.|.. .:.|.
Zfish   128 --VASSGRSTSSVIPSGVTWVKSKVAEFDPEKNTVHTDCGKKISYDYLIVALGLELHYE-KIKGL 189

  Fly   239 REGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTC--- 300
            .||.|:  |||.....:.:|:...|   |:...:..:..|             .:|||...|   
Zfish   190 PEGFEH--PKIGSNYSLKTVEKTWD---ALKSFKEGNALF-------------TFPNTPVKCAGA 236

  Fly   301 DSPLQFSDDGGI-------SVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMA 358
            ...:.:..|..:       ..:.:..|:|..:|.......|.|..          .:.|.:....
Zfish   237 PQKIMYLSDAFLRKTGKRSKANIIFNTSLPVLFGVKKYADALWEI----------VKKRDLNVNL 291

  Fly   359 GRSM--AAASEGESVYQD---------FCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRC 412
            ..::  ..|.:.|:::::         |.:|:. |||...|.|.||.|... .|.|...::....
Zfish   292 RHNLIEVRADKQEALFENLDKPGETEVFKYEML-HVTPPMGPPAVLKGSLL-DDAGGWLDVNKNT 354

  Fly   413 TRNKEY 418
            .::|.|
Zfish   355 LQHKTY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 52/255 (20%)
sqorXP_005163218.1 FadH2 78..418 CDD:223523 65/325 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.