DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001017244.1 Gene:aifm1 XenbaseID:XB-GENE-1016872 Length:636 Species:Xenopus tropicalis

Alignment Length:417 Identity:87/418 (21%)
Similarity:162/418 (39%) Gaps:132/418 (32%)


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYL--------------HKF 57
            ||::|||.|..:.|.|:....|.|.:|::::.|.:..:.  .|:::.|              .::
 Frog   156 FLLIGGGTASFAAARSIRARDPGARVLIVSDESELPYMR--PPLSKELWFSEDPHVTETLRFKQW 218

  Fly    58 DVREQDVSEMGASFQTLVDRL----------------DHINSREHCIRTKAGLEIKYRYLCLCTG 106
            :.:|:.:.....||....::|                .|::.||:.::...|.:|.|....:.||
 Frog   219 NGKERSIFFQPPSFYVPPEQLMSVENGGVSVLTGKKVVHMDVRENKVKLDDGTQISYEKCLIATG 283

  Fly   107 GTPKLF-----SGKVVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW 166
            |.|:..     :|:.|.......|.....:.|:...::...:.|:|.|.:.||||          
 Frog   284 GVPRSLPAIERAGEEVTKRTTLFRRISDFRTLEAISSSVGSITIIGGGFLGSELA---------- 338

  Fly   167 VVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDW-- 229
                                 .|:.....:.|..|:        ::.|  ::.|.|..| |::  
 Frog   339 ---------------------CALGRKGTQTSLEVI--------QMFP--ESGNMGKVL-PEYLS 371

  Fly   230 HRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVK----------LEHEDGSFQQLTCD 284
            |.:.: ...|||                |..|:|   |:||          ::.:||  :|:..|
 Frog   372 HWTTE-KVQREG----------------VNVLSD---AVVKSVSYQNGKLHIQLKDG--RQVQTD 414

  Fly   285 FIVSATGVWPNTDYTCDSPLQFSDD-GGISVD-EMMRTNLVDVFAAGDVCTANWPAAMHWFQMRL 347
            .||:|.|:.|||:....:.|:...| ||..|: |:...|  :|:.|||        |..::.::|
 Frog   415 HIVAAVGLEPNTELAKSAGLELDGDFGGYRVNAELQARN--NVWVAGD--------AACFYDIKL 469

  Fly   348 WTQ-------ARQMGSMAGRSMAAASE 367
            ..:       |...|.:||.:|..|::
 Frog   470 GRRRVEHHDHAVVSGRLAGENMTGAAK 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 81/403 (20%)
aifm1NP_001017244.1 Pyr_redox_2 159..469 CDD:285266 78/386 (20%)
Pyr_redox 324..408 CDD:278498 26/146 (18%)
AIF_C 487..616 CDD:291391 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.