DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and sqor

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001015687.1 Gene:sqor XenbaseID:XB-GENE-957726 Length:449 Species:Xenopus tropicalis

Alignment Length:477 Identity:85/478 (18%)
Similarity:163/478 (34%) Gaps:143/478 (30%)


  Fly     6 EFLVVGGGIAGVSC---------AESLAIYRPNAS-----ILLLTESSIVKSVTNLVPVARYLHK 56
            :.:|||||..|::.         |..:|:..|:.:     :..|......|..::..|.|     
 Frog    44 DVVVVGGGAGGITMSARMKRKVGAGKVAVIEPSETHYYQPMWTLVGGGAKKLASSARPTA----- 103

  Fly    57 FDVREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTG---------GTPKLF 112
                    |.:.:..:.:...:...:..::|||.....||.|:||.:..|         |.|:.|
 Frog   104 --------SVIPSGVKWIKSEVKGFDPEKNCIRIDDDKEISYKYLIIALGLKLQYEKIKGLPEGF 160

  Fly   113 SGKVVNPLVIGIRDTDSVQLLQRKLATAKD------VLILGN-----GGIASELAYELKDVNVHW 166
                 |...||  ...||:.:::.....:|      :....|     .|...::.|         
 Frog   161 -----NYPKIG--SNYSVKTVEKTWKALQDFKKGNAIFTFPNTPVKCAGAPQKIMY--------- 209

  Fly   167 VVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHR 231
             :.:.::..|.....|...|:.::        ..:..:|  :|::.|                  
 Frog   210 -LSEEYLRKTGKRSNANIIFNTSL--------GVIFGVK--KYADAL------------------ 245

  Fly   232 SVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNT 296
             :::...|:.:.|      ||..:..|:  .|...|:.:...:.|..:....:.:.....:.| .
 Frog   246 -LEIIKERDIQVN------YKHSLIEVR--PDVQEAVFENLDKPGETKVFQYEMLHVTPPMGP-P 300

  Fly   297 DYTCDSPLQFSDDGG---ISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGS-- 356
            |...:||:  ||..|   :|.|.:......:||..|| || |.|.:.  ....:..|:..:..  
 Frog   301 DVLVNSPV--SDAAGWVDVSKDTLQHKKYPNVFGIGD-CT-NLPTSK--TAAAIAAQSAVLDKTI 359

  Fly   357 ---MAGRSMAAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEY 418
               |..:|::|..:|           :.....:.||..|:|..|       ||        |::.
 Frog   360 SFVMKNQSLSAKYDG-----------YTSCPLVTGYRKVILAEF-------DY--------NQQP 398

  Fly   419 IK-FVLQNGRLRGAMLIGNTDL 439
            :: |.:..|:.|..|.....||
 Frog   399 LETFPIDQGKERRTMYHMKADL 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 67/384 (17%)
sqorNP_001015687.1 FadH2 51..>344 CDD:223523 62/367 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.