DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and pyroxd1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_957057.1 Gene:pyroxd1 ZFINID:ZDB-GENE-040426-1732 Length:490 Species:Danio rerio

Alignment Length:497 Identity:236/498 (47%)
Similarity:312/498 (63%) Gaps:43/498 (9%)


  Fly     3 RKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQD---V 64
            ::.:|::||||||||:|||.:|...|:..:.|||.|.:||.|||...|::.|.:||:.||.   :
Zfish    10 KQVKFVIVGGGIAGVTCAEQIASQFPSDEVCLLTASPLVKKVTNFRQVSKTLEEFDIEEQPSRVL 74

  Fly    65 SEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDS 129
            .|...:.:.|...:..:.:|||.:.|:.|....||.||||:||.|||.|..  ||.|:|||||||
Zfish    75 EEKYPNLKVLQSAVRLLKAREHLLETEDGQRFFYRKLCLCSGGRPKLLSKD--NPHVLGIRDTDS 137

  Fly   130 VQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECN 194
            .|..|::|:|||.::::||||||.||.||::...|.|.|||..|..||.|.|||:|. |...|.:
Zfish   138 AQEFQKRLSTAKRIVVIGNGGIALELVYEVEGCEVIWAVKDKAIGNTFFDAGAAQFL-IPSLEAD 201

  Fly   195 AKDSSPVVAIKRMRY----SEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKSRI 255
            .:::|.|  .||.||    |.......::..|:|||||||..::|.||::..  |...|.|:..:
Zfish   202 RREASSV--CKRARYTTDSSAAGHSGSSSELGSALGPDWHEGIELRGAKQSV--RGVHIEYECEV 262

  Fly   256 SSV---QDLADDAGAIVKLEHEDG----------SFQQLT------CDFIVSATGVWPNTD-YTC 300
            ..:   |:|         |:.|.|          ::.|||      ||||||||||.|||| :..
Zfish   263 EQIYTQQEL---------LQSEHGTKTAELGVWPAYVQLTNGKIYGCDFIVSATGVVPNTDPFLP 318

  Fly   301 DSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSMAAA 365
            .:....:.|.|:.||:.|||:..|||||||||:|.|..:..|.||||||||||||..|.|.|||.
Zfish   319 GNNFDVAADLGLLVDDHMRTSEADVFAAGDVCSAGWEPSSIWQQMRLWTQARQMGWYAARCMAAD 383

  Fly   366 SEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGRLRG 430
            ...|.:..|||||||.|:||.|.|.|||||:||.|.||:|:|:|||||:.:||:|.||..||:.|
Zfish   384 VLDEPIELDFCFELFSHITKFFNYKVVLLGKFNAQGLGQDHELLVRCTKGQEYVKVVLSGGRMVG 448

  Fly   431 AMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            |:|||.|||.||.||||||.:||..||:::|||:||||||||
Zfish   449 AVLIGETDLEETFENLILNQMDLTRYGEELLNPNIDIEDYFD 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 161/374 (43%)
pyroxd1NP_957057.1 Pyr_redox_2 13..373 CDD:285266 162/376 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355669524
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H11758
Inparanoid 1 1.050 412 1.000 Inparanoid score I1779
OMA 1 1.010
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 1 1.000 FOG0006040
OrthoInspector 1 1.000 T1053500
orthoMCL 1 0.900 OOG5_132357
Panther 1 1.100 LDO PTHR43429
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3689
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.