| Sequence 1: | NP_001260619.1 | Gene: | Pyroxd1 / 35296 | FlyBaseID: | FBgn0032846 | Length: | 472 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647877.1 | Gene: | CG14997 / 38514 | FlyBaseID: | FBgn0035515 | Length: | 457 | Species: | Drosophila melanogaster |
| Alignment Length: | 500 | Identity: | 97/500 - (19%) |
|---|---|---|---|
| Similarity: | 171/500 - (34%) | Gaps: | 157/500 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 RKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHK--FDVREQDVS 65
Fly 66 EMGASFQTLVDRLD-----------HINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNP 119
Fly 120 LVIGIRDT--------------DSVQLLQRKLATAKDVLILGN-----GGIASELAYELKDVNVH 165
Fly 166 WVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVV-AIKRMRYSEVLPKEQTNNHGAALGPDW 229
Fly 230 HRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQL------------- 281
Fly 282 TCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDE--MMRTNLVDVFAAGDVCTANWPAAMHWFQ 344
Fly 345 MRLWTQARQMGSMAGRSMAAASEGES---VYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDY 406
Fly 407 EILVRCTRNKEYIKFVLQNGRLRGAMLIGNTDLAETCE-NLILNG 450 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pyroxd1 | NP_001260619.1 | Pyr_redox_2 | 8..355 | CDD:285266 | 76/394 (19%) |
| CG14997 | NP_647877.1 | Pyr_redox_2 | 59..342 | CDD:285266 | 66/362 (18%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0446 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||