DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_005165182.1 Gene:aifm1 ZFINID:ZDB-GENE-030826-11 Length:748 Species:Danio rerio

Alignment Length:408 Identity:90/409 (22%)
Similarity:159/409 (39%) Gaps:114/409 (28%)


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTESSIV----------------KSVTNLVPVARYLH 55
            :|::|||.|..:.|.|:....|.|.:|::||.|.:                ..||..:...::..
Zfish   271 YLLIGGGTASFAAARSIRARDPGARVLIITEESDLPYMRPPLSKELWFSDDPKVTESLRFKQWNG 335

  Fly    56 K----------FDVREQDVSEM-GASFQTLVD-RLDHINSREHCIRTKAGLEIKYRYLCLCTGGT 108
            |          |.|...|:::: ......|.| ::.|::.|.:.::...|.||.|....:.|||.
Zfish   336 KERSIYFQPPSFYVSPADLAKVENGGVAVLTDSKVVHMDVRGNKVKLSDGSEISYEKCLIATGGV 400

  Fly   109 PKLF-----SGKVV---NPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVH 165
            |:..     :|:.|   ..|...|.|..|::.:.|::   |.:.|:|.|.:.||||..|      
Zfish   401 PRNLQVIDRAGEEVIKRTTLFRKIEDFRSLEKISREV---KSITIIGGGFLGSELACAL------ 456

  Fly   166 WVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDW- 229
                    .....||| .|...:...:.|              ..:|||:..:|         | 
Zfish   457 --------GRRSADPG-LEVMQLFPEKGN--------------MGKVLPEYLSN---------WT 489

  Fly   230 HRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWP 294
            ...|...|.....:..:..:.||:....:: |.|  |.:||.:|            ||:|.|:.|
Zfish   490 TEKVRKEGVNVITDAVVKNVTYKNDKLEIK-LKD--GRLVKTDH------------IVAAVGLEP 539

  Fly   295 NTDYTCDSPLQF-SDDGG--ISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQ------ 350
            :.:....:.|:. ||.||  ::.:...|:|   ::.|||        |..::.::|..:      
Zfish   540 SVELAKSAGLEVDSDFGGYRVNAELQARSN---IWVAGD--------AACFYDIKLGRRRVEHHD 593

  Fly   351 -ARQMGSMAGRSMAAASE 367
             |...|.:||.:|..|::
Zfish   594 HAVVSGRLAGENMTGANK 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 85/394 (22%)
aifm1XP_005165182.1 AIF-MLS <56..203 CDD:291623
Pyr_redox_2 274..584 CDD:285266 82/377 (22%)
Pyr_redox 439..523 CDD:278498 24/125 (19%)
AIF_C 602..728 CDD:291391 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.