DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and Aifm2

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_006256514.1 Gene:Aifm2 / 361843 RGDID:1304964 Length:404 Species:Rattus norvegicus


Alignment Length:446 Identity:76/446 - (17%)
Similarity:157/446 - (35%) Gaps:133/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVGGGIAGVSCAESL--------------AIYRPNASILLLTESSIVKSVTNLVPVARYLHKFD 58
            ::||||..|::.|..|              :.:...|::....||...|         :....:.
  Rat    45 VIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAK---------KTFISYS 100

  Fly    59 VREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGT---PKLFSGKVVNPL 120
            |..:|....|        ::..|:.:...:..:.|..:.:.:|.|.||.|   |..|:.......
  Rat   101 VTFKDNFRQG--------KVIGIDLKNRMVLLEGGEALPFSHLILATGSTGPFPGKFNEVSCQQA 157

  Fly   121 VIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEF 185
            .|...: |.|:.:||    ::.::::|.|....|:|.|:|.......|...|......|      
  Rat   158 AIQAYE-DMVKQIQR----SQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLAD------ 211

  Fly   186 FHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIY 250
                      |:..|.|   |....|:|                        .|:|.:     :.
  Rat   212 ----------KELLPCV---RQEVKEIL------------------------LRKGVQ-----LL 234

  Fly   251 YKSRISSVQDL-ADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTD--YTCDSPLQFSDDGGI 312
            ...|:|::::| .::....:|:|.:.|:  ::..:.::...|:..|:.  .:..:..:.:.:|.:
  Rat   235 LSERVSNLEELPRNEYREYIKVETDKGT--EVATNMVIVCNGIKINSSAYRSAFAESRLASNGAL 297

  Fly   313 SVDEMMRT-NLVDVFAAGDVCTANWP-----AAMHWFQMRLWTQARQMGSMAGRSMAAASEGESV 371
            .|:|.::. ...:::|.||......|     |.:|    .....|..:.||..|.:.|...|...
  Rat   298 KVNEFLQVEGYSNIYAIGDCADIKEPKMAYHAGLH----ANIAVANIVNSMKQRPLKAYKPGALT 358

  Fly   372 YQDFCFELFGHVTKLFGYPVVLL--------GRFNGQDLGRDYEILVRCTRNKEYI 419
            :                    ||        |:.:|..:||   ::||..::::.:
  Rat   359 F--------------------LLSMGRNDGVGQISGFYVGR---LMVRLAKSRDLL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 63/372 (17%)
Aifm2XP_006256514.1 Pyr_redox_2 50..333 CDD:285266 59/358 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.