DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Pyroxd1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001004234.1 Gene:Pyroxd1 RGDID:1303253 Length:498 Species:Rattus norvegicus

Alignment Length:497 Identity:237/498 (48%)
Similarity:310/498 (62%) Gaps:39/498 (8%)


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGASF 71
            |:|||||||||:|||.|||..|...|||:|.|.::|:|||...|::.|.:|||.||..:.:...|
  Rat    10 FVVVGGGIAGVTCAEQLAINFPAEDILLVTASPVIKAVTNFKQVSKVLEEFDVEEQPSTMLENRF 74

  Fly    72 ---QTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLF-SGKVVNPLVIGIRDTDSVQL 132
               :.:...:..:.|.:|||.|:.|.|..|:.||||.|..|||. .|   ||.|:|||||||.|.
  Rat    75 PNIKVIESGVKQLKSDKHCIFTEDGREYVYKKLCLCAGAKPKLICEG---NPYVLGIRDTDSAQE 136

  Fly   133 LQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKD 197
            .|::|..|:.::|:||||||.|||||::...|.|.:||..|..||.|.|||||.   .:...::.
  Rat   137 FQKQLTKARRIMIVGNGGIALELAYEVEVCEVIWAIKDKAIGNTFFDAGAAEFL---TSRLLSEK 198

  Fly   198 SSPVVAIKRMRYSEVLPKEQTNNH------GAALGPDWHRSVDLSGAREGEEN-------RLPKI 249
            |...:|.||..|:....|::|:..      |:|||||||..:.|.|..|...:       .:.||
  Rat   199 SEAKLAHKRTIYTVEEAKKETSTKSKADYVGSALGPDWHGGLALKGTEEFSHSIHIETKCEVKKI 263

  Fly   250 YYKS--RISSVQDLA---DDAGAI--------VKLEHEDGSFQQLTCDFIVSATGVWPNTD-YTC 300
            |.:.  :|...:.||   |...::        |.:|..:||.  ..|||:||||||.||.. :..
  Rat   264 YLQEEFKIMKKKSLAFPKDHHKSVTVDKEMWPVYVELTNGSI--YGCDFLVSATGVTPNVQPFLH 326

  Fly   301 DSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSMAAA 365
            .:.....:|||:.|||.|||:|.|::||||:|||.||.:..|.||||||||||||..|.:.||||
  Rat   327 GNDFDLGEDGGLRVDEQMRTSLPDIYAAGDICTACWPPSPVWQQMRLWTQARQMGCYAAKCMAAA 391

  Fly   366 SEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGRLRG 430
            :.|..:..||.||||.||||.|.|.|||||::|.|.||.|:|:::||||.:||||.|:.|||:.|
  Rat   392 TMGHPIDMDFSFELFAHVTKFFNYKVVLLGKYNAQGLGVDHELMLRCTRGQEYIKVVMHNGRMMG 456

  Fly   431 AMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            |:|||.|||.||.||||||.:||..||:|:||||||||||||
  Rat   457 AVLIGETDLEETFENLILNQMDLSSYGEDLLNPDIDIEDYFD 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 161/378 (43%)
Pyroxd1NP_001004234.1 Pyr_redox_2 <76..381 CDD:285266 138/333 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355666059
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H11758
Inparanoid 1 1.050 415 1.000 Inparanoid score I1744
OMA 1 1.010
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 1 1.000 FOG0006040
OrthoInspector 1 1.000 T1087862
orthoMCL 1 0.900 OOG5_132357
Panther 1 1.100 LDO PTHR43429
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.