DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Pyroxd1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_898988.2 Gene:Pyroxd1 MGIID:2676395 Length:498 Species:Mus musculus

Alignment Length:500 Identity:233/500 (47%)
Similarity:313/500 (63%) Gaps:45/500 (9%)


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGASF 71
            |:|||||||||:|||.||:..|...|||:|.|.::|:|||...|::.|.:|||.||..:.:.:.|
Mouse    10 FVVVGGGIAGVTCAEQLAVSFPEEDILLVTASPVIKAVTNFRQVSKVLEEFDVEEQPGTMLESRF 74

  Fly    72 ---QTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKL-FSGKVVNPLVIGIRDTDSVQL 132
               :.:...:..:.|.:|||.|:.|.|..|:.||||.|..||| :.|   ||.|:|||||||.|.
Mouse    75 PNIKVIESGVKQLKSEDHCIFTEDGREFVYKKLCLCAGAKPKLIYEG---NPRVLGIRDTDSAQE 136

  Fly   133 LQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKD 197
            .|::||.|:.::|:||||||.|||||::...|.|.:||:.|..||.|.|||||.   .::..::.
Mouse   137 FQKELAKARRIMIVGNGGIALELAYEIEGCEVVWAIKDNAIGNTFFDAGAAEFL---TSKLMSEK 198

  Fly   198 SSPVVAIKRMRYS------EVLPKEQTNNHGAALGPDWHRSVDLSGAREGEEN-------RLPKI 249
            |...:|.||..|:      |...|.:.:..|:|||||||..:.|.|..|...:       .:.||
Mouse   199 SEAKIAHKRTIYTVEEAKKETRTKSKADYVGSALGPDWHGGLALKGTEEFSHSVHIETRCEVKKI 263

  Fly   250 YYKS--RISSVQDLADDAGAIVKLEHEDGS--------FQQLT------CDFIVSATGVWPNT-D 297
            |.:.  :|...:.|     |..|..|:..:        :.:||      |||:||||||.||. .
Mouse   264 YLEEEFKIMKKKSL-----AFPKDHHKSVTADKEMWPVYVELTNGTIYGCDFLVSATGVTPNVHP 323

  Fly   298 YTCDSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSM 362
            :...:.....:|||:.||:.|||:|.|::||||:|||.|..:..|.||||||||||||..|.:.|
Mouse   324 FLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTACWQPSPVWQQMRLWTQARQMGYYAAKCM 388

  Fly   363 AAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGR 427
            ||||.|..:..||.||||.||||.|.|.|||||::|.|.||.|:|:::||||.:||:|.|:||||
Mouse   389 AAASMGHPIDMDFSFELFAHVTKFFNYKVVLLGKYNAQGLGADHELMLRCTRGQEYVKVVMQNGR 453

  Fly   428 LRGAMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            :.||:|||.|||.||.||||||.:||..||:|:|:|:||||||||
Mouse   454 MMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNIDIEDYFD 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 158/381 (41%)
Pyroxd1NP_898988.2 Pyr_redox_2 <76..381 CDD:285266 137/336 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355667385
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H11758
Inparanoid 1 1.050 416 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006040
OrthoInspector 1 1.000 T1084312
orthoMCL 1 0.900 OOG5_132357
Panther 1 1.100 LDO PTHR43429
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3689
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.