DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and Y9C9A.16

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001263749.1 Gene:Y9C9A.16 WormBaseID:WBGene00021183 Length:422 Species:Caenorhabditis elegans

Alignment Length:378 Identity:84/379 (22%)
Similarity:134/379 (35%) Gaps:119/379 (31%)


  Fly     6 EFLVVGGGIAGVSCAE---------SLAI--------YRPNASIL---LLTESSIVKSVTNLVPV 50
            :.||||||..|:..|.         ||.|        |:|..:::   |:|..|..|...||:| 
 Worm    13 KLLVVGGGAGGLGIASKFTRKLPSGSLGIIEPLEDHYYQPGFTLVGGGLMTLDSNRKKQVNLIP- 76

  Fly    51 ARYLHKFDVREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGK 115
                            .||::  :.|:::..|..::.:..:.|.||.|.|:.:..|         
 Worm    77 ----------------KGATW--IQDKVETFNPSQNTVVLRGGEEISYEYMVIAMG--------- 114

  Fly   116 VVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW--VVKDSHISATFV 178
                  |.:| .|.::.....|.|.         |:.|.  |....|..|:  |:.....:|.:.
 Worm   115 ------IHLR-FDMIKGAVEALETP---------GVCSN--YSPFHVQKHYQEVMNFQKGNAIYT 161

  Fly   179 DP-------GAAEFFHIAMNECNAKDSSPVVAIKRMR---------YSEVLPKEQTNNHGAALGP 227
            .|       ||.:      ..|...||     |.|.|         |:..|.|        ..|.
 Worm   162 FPNTPIKCAGAPQ------KACYITDS-----ILRQRGVRDKAHMIYATSLSK--------IFGV 207

  Fly   228 DWHRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGV 292
            |.:.......|:|      ..|..|::.:.::.:.::..||.:|..:|.....:|.:...|...:
 Worm   208 DHYVKALEKVAQE------KTIEVKTKRNLIEVVTNNKKAIFELLGDDSKPTGVTEEIEFSLLHI 266

  Fly   293 WPNTDYTCDSPLQ---FSDDGG-ISVD--EMMRTNLVDVFAAGDVCTANWPAA 339
            .|  ..|...||:   |:|..| :.||  .:...|..:||..|| | .|.|.|
 Worm   267 SP--PCTAPEPLRSSHFADKTGFMDVDPQTLQSKNYPNVFGVGD-C-MNTPNA 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 84/377 (22%)
Y9C9A.16NP_001263749.1 FadH2 21..>355 CDD:223523 78/371 (21%)
NADB_Rossmann <47..186 CDD:304358 39/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.