DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and C26D10.3

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_495754.3 Gene:C26D10.3 WormBaseID:WBGene00007744 Length:475 Species:Caenorhabditis elegans

Alignment Length:485 Identity:174/486 (36%)
Similarity:271/486 (56%) Gaps:29/486 (6%)


  Fly     6 EFLVVGGGIAGVSCA-ESLAIYR-PNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEM- 67
            ::::||||||||||| :.|.:.| .|..:::::.||.||||.|...:.:|..||||:|.:..|: 
 Worm     2 KYIIVGGGIAGVSCASQMLQLERSANLEVIIISASSFVKSVENYQKIGQYGEKFDVKETNCHELF 66

  Fly    68 -GASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQ 131
             .:..:.|.|.:...:|.::.|..:...::||..||:.||..||......::..::.:|||.|..
 Worm    67 PDSRIRFLNDTVVTWDSSKNEIHLQNNEKLKYDKLCIATGSRPKFQKELGIDRRIVFLRDTQSAI 131

  Fly   132 LLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFF-------HIA 189
            .|:.||..||::||:||||||:||.:|||..:|.|::||..|.|:|......:|.       .|.
 Worm   132 QLKTKLKNAKNILIVGNGGIATELIFELKTFDVTWLIKDPWICASFFPEDIEQFIEKRLLKGRID 196

  Fly   190 MNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKSR 254
            .|:.:.:...    ::.:..||.:.:...|..|.||||||...:|.....|..|||...|.....
 Worm   197 GNKHDGQQKH----LQHVAASESVSENMNNPSGPALGPDWCSQIDFQKISEKSENRSVTILRNCV 257

  Fly   255 ISSV---QDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTD-YTCDSPLQFSDDGGISVD 315
            |:|.   |:|     ::..::.|..:..||..|..:.|.||..|:: :..:..||.:::.||.|:
 Worm   258 ITSTDTSQNL-----SVHYMDKEKMADNQLNPDIFIWAGGVTANSEVWAMNKMLQITENSGIKVN 317

  Fly   316 EMMRTNLVDVFAAGDVC--TANWPAAMHWFQMRLWTQARQMGSMAGRSMAAASEGESVYQDFCFE 378
            :...|:|.:|||.||||  |...|:.: |.|.:|||||||.|.:.||:|.|..| |:..|:..||
 Worm   318 DACETSLPNVFACGDVCALTTTEPSTL-WQQRQLWTQARQQGEVCGRAMVAGVE-EARMQNMYFE 380

  Fly   379 LFGHVTKLFGYPVVLLGRFNGQ-DLGRDYEILVRCTRNKEYIKFVLQNGRLRGAMLIGNTDLAET 442
            ||.|.|..||..||.||.:..: .:..:::|::|...|.:.::.|:...::.||:|||.||:.||
 Worm   381 LFSHCTTFFGLKVVFLGDYKPERQVEGEWKIVLRDADNDQLVRCVVVKNKIVGALLIGETDMEET 445

  Fly   443 CENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            .||||||..|||...:..|.|.:|::||||
 Worm   446 LENLILNKTDLEGISETFLEPGVDLDDYFD 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 125/364 (34%)
C26D10.3NP_495754.3 Pyr_redox_2 1..358 CDD:285266 125/366 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355327231
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H11758
Inparanoid 1 1.050 275 1.000 Inparanoid score I1772
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 1 1.000 FOG0006040
OrthoInspector 1 1.000 T476633
orthoMCL 1 0.900 OOG5_132357
Panther 1 1.100 LDO PTHR43429
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3689
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.