DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and F20D6.11

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_505112.1 Gene:F20D6.11 WormBaseID:WBGene00017640 Length:549 Species:Caenorhabditis elegans

Alignment Length:471 Identity:99/472 (21%)
Similarity:173/472 (37%) Gaps:111/472 (24%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYL---------HKFDVREQD 63
            :::|||:|..:..|...:......||:::|.|       |.|..|.|         ....:|:.|
 Worm   147 VIIGGGVATATFIEHSRLNGLITPILVISEES-------LPPYDRVLLSKKPAATGEDIRLRKDD 204

  Fly    64 V--SEMGASF--QTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGI 124
            .  .|....|  :|.|..::| .|||  :....|..:.|..|.:.|||.        |..|.:..
 Worm   205 AFYEERNVKFLLKTSVIAVNH-KSRE--VSLSNGETVVYSKLIIATGGN--------VRKLQVPG 258

  Fly   125 RDTDSVQLLQR--------KLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPG 181
            .|..::..|::        .|...|.|:.:|:..|..|:|..|                      
 Worm   259 SDLKNICYLRKVEEANIISNLHPGKHVVCVGSSFIGMEVASAL---------------------- 301

  Fly   182 AAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRL 246
                         |:.::.|..|...  .|.||         ..|.|..:.:.|....:|     
 Worm   302 -------------AEKAASVTVISNT--PEPLP---------VFGSDIGKGIRLKFEEKG----- 337

  Fly   247 PKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGG 311
              :.::...:.|....:|.|.:.|:..|:|  ::|..|.:|...||.|.|.:...|.::..:.|.
 Worm   338 --VKFELAANVVALRGNDQGEVSKVILENG--KELDVDLLVCGIGVTPATKFLEGSGIKLDNRGF 398

  Fly   312 ISVDEMMRTNLVDVFAAGDVCTANWPAAMHW----FQMRLWTQARQMGSMAGRSMAAASEGESVY 372
            |.|||..|||:..:||.|||.||..|.   |    ..::.:..|:..|...|.::....:...:.
 Worm   399 IEVDEKFRTNISYIFAMGDVVTAPLPL---WDIDSINIQHFQTAQAHGQHLGYTIVGKPQPGPIV 460

  Fly   373 QDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGRLRGAMLIGNT 437
            ..| :.||     .|.:.:    :|:|.:.|...|..........:|::.|:..::......|.:
 Worm   461 PYF-WTLF-----FFAFGL----KFSGCNQGSTKEYTNGDPETGTFIRYFLKKDKVVAVAAGGPS 515

  Fly   438 DLAETCENLILNGIDL 453
            .:|.....:...||::
 Worm   516 SVASQFAEIFKKGIEV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 83/372 (22%)
F20D6.11NP_505112.1 Rieske_AIFL_N 29..118 CDD:239560
Pyr_redox_2 146..443 CDD:285266 83/372 (22%)
Pyr_redox 284..365 CDD:278498 21/134 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.