DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and sqrd-1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001255798.1 Gene:sqrd-1 WormBaseID:WBGene00008538 Length:471 Species:Caenorhabditis elegans

Alignment Length:398 Identity:75/399 (19%)
Similarity:138/399 (35%) Gaps:110/399 (28%)


  Fly     6 EFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDV---REQDVSEM 67
            :.||||||..|:..|...|...|..|:.::..............|...|...:.   :::|:...
 Worm    13 KLLVVGGGAGGLGAASKFARKLPRGSVGIIEPREDHYYQPGFTLVGGGLMSLEANRGKQKDLIPK 77

  Fly    68 GASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQL 132
            .|::  :.|::......::.::.:.|.||.|.|:.:..|                       |||
 Worm    78 NATW--IQDKVQKFEPAKNSVKLRGGDEITYDYMVIAMG-----------------------VQL 117

  Fly   133 LQRKLATAKDVLILGNGGIASEL-----------AYELKDVNVHWVVKDSHISATFVDPGAAEFF 186
            ....:..||:.  |...|:.|..           |...|..|..:...::.|........|....
 Worm   118 RYDMIKGAKEA--LDTPGVCSNYSPFYVEKHYKEAMNFKGGNALYTFPNTPIKCAGAPQKACYIT 180

  Fly   187 HIAMNECNAKDSSPVV---AIKRMRYS---EVLPKEQTNNHGAALGPD-------WHRSVDLSGA 238
            ...:.:...:|.:.::   ::||:|:.   :::      ||| |:|..       .|:.|.:   
 Worm   181 DSILRQRGVRDQAHMIYATSLKRVRFLLCWDII------NHG-AIGNQKSKKKIRKHQLVTI--- 235

  Fly   239 REGEENRLPKIY---------YKSRISSVQDLADDAGA-------IVKLEHED--GSFQQLTCDF 285
             :..:|.:.|.|         .:|.:.|::.:|.|...       ::::...|  .:|:.|  |.
 Worm   236 -DCFDNNILKQYNNFFFHLFGIESYLKSLEKVARDKEIDVRTRRNLIEVNTNDRIATFELL--DE 297

  Fly   286 IVSATGVWPNTDYT-------CDSP-----------LQFSD-DGGISVDEMMRTNLVDVFAAGDV 331
            ....||.....:|:       |.:|           ..|.| |||    .:......:||..|| 
 Worm   298 EAKPTGKTEQIEYSLLHIGPPCSTPEALRNSAFVDKTGFMDVDGG----SLQSKKYPNVFGVGD- 357

  Fly   332 CTANWPAA 339
            | .|.|.|
 Worm   358 C-MNTPNA 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 75/397 (19%)
sqrd-1NP_001255798.1 FadH2 28..>377 CDD:223523 67/384 (17%)
NADB_Rossmann 28..186 CDD:304358 27/185 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.