DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and wah-1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_499564.2 Gene:wah-1 WormBaseID:WBGene00006937 Length:700 Species:Caenorhabditis elegans

Alignment Length:418 Identity:89/419 (21%)
Similarity:166/419 (40%) Gaps:106/419 (25%)


  Fly     5 CEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKF------------ 57
            ||::::|.|.|....:.|:...:..|.:|::.|..  :...|..|:::.|..:            
 Worm   240 CEYVIIGSGTAAYYASLSIRAKQAEAKVLMIGEEP--ELPYNRPPLSKELWWYGDETSATKLAYT 302

  Fly    58 --DVREQDV-SEMGASFQTLVDRLDHINSREHCIRTKA---------------GLEIKYRYLCLC 104
              ..:::|: .|:...|.:..|....::.....:|.:.               |..|.|..|.:.
 Worm   303 PLSGKKRDIFYEVDGFFVSPEDLPKAVHGGVALLRGRKAVKICEEDKKVILEDGTTIGYDKLLIA 367

  Fly   105 TGGTPK---LF--SGKVVNPLVIGIRDTDSVQLLQRKLA--TAKDVLILGNGGIASELAYELK-- 160
            ||..||   :|  :.:.....:.........:.::|.||  :.:.|.|:|||.:||||:|.:|  
 Worm   368 TGVRPKKEQVFEEASEEAKQKITYFHYPADFKRVERGLADKSVQKVTIIGNGLLASELSYSIKRK 432

  Fly   161 ---DVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHG 222
               :|.||.|.::.:.:...:..      |||...        :.||::.               
 Worm   433 YGENVEVHQVFEEKYPAEDILPE------HIAQKS--------IEAIRKG--------------- 468

  Fly   223 AALGPDWHRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIV 287
               |.|......:.|.|:..:|                        |.|:..|||  :|..|.:|
 Worm   469 ---GVDVRAEQKVEGVRKCCKN------------------------VVLKLSDGS--ELRTDLVV 504

  Fly   288 SATGVWPNTDYTCDSPLQFSDD-GGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQA 351
            .|||..||::....|.|:..:. ||:..|:.::.. .:|:|||.:.|.. ...:...::..|..|
 Worm   505 VATGEEPNSEIIEASGLKIDEKLGGVRADKCLKVG-ENVWAAGAIATFE-DGVLGARRVSSWENA 567

  Fly   352 RQMGSMAGRSMA-AASEGESVYQDFCFE 378
            :..|.:||.:|| ||::|:|..:.|.::
 Worm   568 QISGRLAGENMATAAADGKSEGKAFWYQ 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 77/390 (20%)
wah-1NP_499564.2 Pyr_redox_2 242..551 CDD:285266 75/370 (20%)
AIF_C 574..669 CDD:291391 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.