DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and AIFM3

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_653305.1 Gene:AIFM3 HGNCID:26398 Length:605 Species:Homo sapiens

Alignment Length:482 Identity:111/483 (23%)
Similarity:177/483 (37%) Gaps:139/483 (29%)


  Fly     2 SRKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSE 66
            |.....|:||.|.||:.|||:|.....:..|:|.|             :.|:|      ..|..:
Human   192 SSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCT-------------LDRHL------PYDRPK 237

  Fly    67 MGASFQTLVDRLDHINSREHC-----------------IRTKA-----GLEIKYRYLCLCTGGTP 109
            :..|..|..::| .:..:|..                 :|||.     |.:::|..|.|..|.:|
Human   238 LSKSLDTQPEQL-ALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSP 301

  Fly   110 KLFS--GKVVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSH 172
            |..|  ||.|.. |..||..:....:.| ||..::|:::|.|.:..|:|        .::.:.:|
Human   302 KTLSCKGKEVEN-VFTIRTPEDANRVVR-LARGRNVVVVGAGFLGMEVA--------AYLTEKAH 356

  Fly   173 ISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSG 237
             |.:.|:                .:.:|.......|....|.|...||.     ..::...::|.
Human   357 -SVSVVE----------------LEETPFRRFLGERVGRALMKMFENNR-----VKFYMQTEVSE 399

  Fly   238 AREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDS 302
            .| |:|.:|.::..||  |.|                      :..|..|...|..|.|.:...|
Human   400 LR-GQEGKLKEVVLKS--SKV----------------------VRADVCVVGIGAVPATGFLRQS 439

  Fly   303 PLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRL-----WTQARQMGSMAGRSM 362
            .:.....|.|.|::||:||:..||||||..|  :|.|  |...|.     |..|...|.:|.::|
Human   440 GIGLDSRGFIPVNKMMQTNVPGVFAAGDAVT--FPLA--WRNNRKVNIPHWQMAHAQGRVAAQNM 500

  Fly   363 AAASEGESVYQDFCFELFGHVTKLFGY-----PVVLLG-----RF-----NGQDL----GRDYEI 408
            .|.....|........:||...:..||     .|::.|     :|     .|.::    ..:|:.
Human   501 LAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDP 565

  Fly   409 LV----------RCTRNKEYIKFVLQN 425
            :|          |..|.:|...|||.:
Human   566 IVSKVAEVLASGRAIRKREVELFVLHS 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 89/376 (24%)
AIFM3NP_653305.1 Rieske_AIFL_N 70..164 CDD:239560
Pyr_redox_2 195..493 CDD:285266 89/379 (23%)
NADB_Rossmann 196..285 CDD:304358 23/109 (21%)
Pyr_redox 334..414 CDD:278498 20/111 (18%)
Reductase_C 512..>562 CDD:291425 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.