DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm3

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_012823655.1 Gene:aifm3 XenbaseID:XB-GENE-5763104 Length:618 Species:Xenopus tropicalis

Alignment Length:444 Identity:99/445 (22%)
Similarity:176/445 (40%) Gaps:124/445 (28%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLT--------ESSIVKSVTN-----LVPVARYLHKFDV 59
            |::|.|.||:.|||:|.....:..|::.|        .|.:.||:.:     .:....:.|.:|:
 Frog   198 LIIGAGPAGLVCAETLRQEGFSDRIVMCTSEKNLPYDRSKLSKSMDSQAEQIFLRSKEFFHTYDI 262

  Fly    60 REQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLF--SGKVVNPLVI 122
            .....|::..           ::::...:..|.|..::|..|.:.||.|||..  .||.::. |.
 Frog   263 EVLTESQVVG-----------VDTKNKMVLFKDGFRMEYNKLLIATGNTPKTLKCKGKELDN-VF 315

  Fly   123 GIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFH 187
            .||..:....:.| ||::|:.:|:|...:..|:|..|                            
 Frog   316 TIRTPEDANKVVR-LASSKNAVIVGASFLGMEVAAYL---------------------------- 351

  Fly   188 IAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYK 252
                 |....|..||.::.:.:.:.|.::                |.|:..:..|.||: |.|.:
 Frog   352 -----CEKAHSVSVVELENIPFKKFLGEK----------------VGLAIMKMFENNRV-KFYMQ 394

  Fly   253 SRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDEM 317
            :.:|   :|.:..|.:.::..:.|  :.|..|..|...|..|.|.:...|.:.....|.|.|::|
 Frog   395 TEVS---ELREQEGKLKEVVLKSG--KVLRADVCVIGIGASPTTGFLKQSGVALDSRGYILVNKM 454

  Fly   318 MRTNLVDVFAAGDVCTANWPAAM---------HWFQMRLWTQARQMGSMAGR-----SMAAASEG 368
            |:||:..|||||||.|  :|.|.         ||          ||..|.||     .:|..:|.
 Frog   455 MQTNIPGVFAAGDVVT--FPLAFRNNKKVNVPHW----------QMAHMQGRIAALNMLAQGTEI 507

  Fly   369 ESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFV 422
            .:|...:        |.:||..:...|..:|.|     :::::  .:.:.:|||
 Frog   508 NTVPYLW--------TAMFGKSIRYAGHGDGFD-----DVIIQ--GDIDELKFV 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 84/371 (23%)
aifm3XP_012823655.1 Rieske_AIFL_N 70..164 CDD:239560
Pyr_redox_2 195..493 CDD:285266 85/375 (23%)
NAD_binding_8 199..>219 CDD:290186 8/20 (40%)
Pyr_redox 334..415 CDD:278498 20/134 (15%)
Reductase_C 512..>582 CDD:291425 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.