DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and aifm3

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001121885.1 Gene:aifm3 ID: Length:599 Species:Danio rerio

Alignment Length:453 Identity:105/454 (23%)
Similarity:176/454 (39%) Gaps:123/454 (27%)


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVAR---------YLHKFDVREQD 63
            |::|.|.||:.|||:|   |...    .|:..::.:....:|..|         ...:..:|..|
Zfish   198 LIIGSGPAGLVCAETL---RQEG----FTDRIVICTTDKHLPYDRPKLSKSLESTAEQLQLRSSD 255

  Fly    64 VSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPK--LFSGKVVNPLVIGIR- 125
            ..:|......|...:..::.:.|.:..:.|.:::||.|.:.||..||  .:.||.|.. |..:| 
Zfish   256 FFQMHDIEVLLEKEVVSVDVKTHTVTFRDGFKMEYRKLFIATGSRPKPLSYKGKDVGN-VFHLRT 319

  Fly   126 --DTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHI 188
              |.:|:.    .||::|:.:|:|...|..|:|..|.|        .:|                
Zfish   320 PEDANSIV----TLASSKNAVIIGTSFIGMEVAAALTD--------KAH---------------- 356

  Fly   189 AMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKS 253
                     |..|:.|:.:.:.:.|.::.    |.||            .:..|.||: |.|   
Zfish   357 ---------SVSVIGIEAVPFRKALGEKV----GKAL------------MKLFESNRV-KFY--- 392

  Fly   254 RISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDEMM 318
            .::.|.::....|.:.::..:.|  :.|..|..|...|..|.|.:...|.:.....|.|.|::.|
Zfish   393 MLNEVWEMRGHNGQLKEVVLKSG--KVLRADVCVIGIGSSPATAFLKQSGVHIDSKGFIPVNKTM 455

  Fly   319 RTNLVDVFAAGDVCT----------ANWPAAMHWFQMRLWTQARQMGSMAGR-----SMAAASEG 368
            :||:..|||.|||.|          .|.|   ||          ||..:.||     .|..||:.
Zfish   456 QTNIDGVFAGGDVVTFPLGLRSNKKVNIP---HW----------QMAHVHGRLAALGIMGKASDI 507

  Fly   369 ESV-YQDFCFELFGHVTKLFGY-----PVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQN 425
            ::| |  |...:||...:..||     .||:.|     ||. :.:.:...|:::|.:.....|
Zfish   508 KTVPY--FWTAMFGKSIRYAGYGDGFDDVVIQG-----DLD-ELKFVAFYTKSEEVVAVASMN 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 85/371 (23%)
aifm3NP_001121885.1 Rieske_AIFL_N 70..164 CDD:239560
Pyr_redox_2 196..493 CDD:285266 85/375 (23%)
NAD_binding_8 199..>218 CDD:290186 9/26 (35%)
Pyr_redox 334..415 CDD:278498 22/134 (16%)
Reductase_C 512..>562 CDD:291425 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.