DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pyroxd1 and pyroxd1

Sequence 1:NP_001260619.1 Gene:Pyroxd1 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001120558.1 Gene:pyroxd1 XenbaseID:XB-GENE-5873721 Length:494 Species:Xenopus tropicalis

Alignment Length:500 Identity:211/500 (42%)
Similarity:302/500 (60%) Gaps:51/500 (10%)


  Fly     6 EFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGAS 70
            :|:|||||||||:|||.||...|:..:.|||.|.::|:.|||..|:|.|..|||.||:.:.:...
 Frog    13 KFVVVGGGIAGVTCAEELAAQFPSDRVYLLTASPLIKATTNLKQVSRTLEAFDVEEQEGTALEGR 77

  Fly    71 F---QTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQL 132
            :   ..:...:..:.|:|..:.|:.|...:|..||||.|...|:.:|.  ||.|:|||||||.:.
 Frog    78 YPNISVVQSAVRELRSQEQEVVTEDGARYRYNKLCLCAGAKAKIIAGG--NPYVLGIRDTDSARE 140

  Fly   133 LQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKD 197
            .||.|::|:.|:|:||||||.||.|||:.....|.::|..|..||.|.|||:|.   :.:..|..
 Frog   141 FQRHLSSARRVVIVGNGGIALELVYELEGCQAIWAIRDGAIGNTFFDAGAAQFL---LPQLGADK 202

  Fly   198 SSPVVAIKRMRYSEVLPKEQTNNH-GAALGPDWHRSVDL--SGAREGEENRLPKIYYKSRISSVQ 259
            ....:..:|.:|:...|....... |:|||||||..::|  :||            :..|: .::
 Frog   203 PPAPLPCRRTKYTTEPPLGGGGGSVGSALGPDWHEGLNLKATGA------------FSHRV-HIE 254

  Fly   260 DLADDAGAIVKLEHE-------------DGS-------FQQLT------CDFIVSATGVWPNTD- 297
            ...:....:::.|.|             |.:       :.|||      ||||||||||.||.: 
 Frog   255 AQCEVRRILLREEREGLNITALPFPGESDSAPSTDWPVYVQLTNGKTYGCDFIVSATGVVPNIEP 319

  Fly   298 YTCDSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSM 362
            :...:....::|||:.|::.|.|::.:::||||:|||:|..:..|.||||||||||||..||:.|
 Frog   320 FVTGNQFDVAEDGGLRVNDHMETSVRNIYAAGDICTASWEPSALWQQMRLWTQARQMGWYAGKCM 384

  Fly   363 AAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGR 427
            ||....:.:..|||||||.||||.|.|.|:|||::|.|.||.|:|:|:|||:.:||:|.||:.||
 Frog   385 AADFLQQPIEMDFCFELFAHVTKFFNYKVILLGKYNAQGLGSDHELLLRCTKGREYVKAVLRGGR 449

  Fly   428 LRGAMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            :.||:|||:|||.||.|||:||.:||.|||:.:|:||:|||||||
 Frog   450 MVGAVLIGDTDLEETFENLMLNQMDLSPYGERLLDPDVDIEDYFD 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 140/380 (37%)
pyroxd1NP_001120558.1 Pyr_redox_2 <85..377 CDD:285266 109/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355665140
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11758
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1463391at2759
OrthoFinder 1 1.000 FOG0006040
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.