DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and VTC3

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_015306.1 Gene:VTC3 SGDID:S000005940 Length:835 Species:Saccharomyces cerevisiae

Alignment Length:199 Identity:50/200 (25%)
Similarity:71/200 (36%) Gaps:60/200 (30%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |.||..|.|.:.|.|:..|::|..||::::   |......|.|.|   .:....|..|..:...|
Yeast     1 MLFGIKLANDVYPPWKDSYIDYERLKKLLK---ESVIHDGRSSVD---SWSERNESDFVEALDKE 59

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLR 130
            |.||..|...|.....|||..|.                             |..:....|:|:.
Yeast    60 LEKVYTFQISKYNAVLRKLDDLE-----------------------------ENTKSAEKIQKIN 95

  Fly   131 LAMSEFYLSLI--------MLQNYQTLNMTAFRKICKKYDK---NLKSEAGFAWYEKYVLKSTLA 184
               ||.:.:.:        .|.|:..||.|.|.||.||:||   |..|           :||.|.
Yeast    96 ---SEQFKNTLEECLDEAQRLDNFDRLNFTGFIKIVKKHDKLHPNYPS-----------VKSLLQ 146

  Fly   185 ITLQ 188
            :.|:
Yeast   147 VRLK 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 42/169 (25%)
SPX 3..163 CDD:281146 42/168 (25%)
EXS 267..601 CDD:281164
VTC3NP_015306.1 SPX 1..561 CDD:328757 50/200 (25%)
VTC1 673..803 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116276692
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.