DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and SYG1

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_012217.3 Gene:SYG1 SGDID:S000001309 Length:902 Species:Saccharomyces cerevisiae

Alignment Length:828 Identity:186/829 (22%)
Similarity:303/829 (37%) Gaps:244/829 (29%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEK----------------------------AP 37
            |||...|....:||||.:|::|...|:.:|...||                            .|
Yeast     1 MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAFQQREP 65

  Fly    38 SGSRPSNDVAIG---------YYRNFEELFFNSCRV--ELTKVNYFFAHKQAEAHRKLATL---- 87
            ..||...|...|         ..|.|...|.....:  :|:|.|.|:.....|..:|...|    
Yeast    66 GKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECDKKFEVLQSQL 130

  Fly    88 -------NYQ---LDRRRAQQDPRGSTASRGSAS------------------------------- 111
                   ||:   |:|..:..|...|..:.|.|.                               
Yeast   131 HYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSVMYGSMPCTKEAKKPR 195

  Fly   112 ------------------SWSRQPEGKRKFPPIKKLRL--------------------------- 131
                              ||.     ||.|..::.||.                           
Yeast   196 LSLLAYCQKVLKDNRLLPSWP-----KRGFSLLQDLRQDASSRGRETFAFGASFLETMTTTQARN 255

  Fly   132 ----AMSEFYLSLIMLQNYQTLNMTAFRKICKKYDK--NLKSEAGFAWYEK--YVL----KSTLA 184
                |:.|:||.|.::::::.:|:|.|||:.||:||  :.:....|..|.:  |.|    .:.:.
Yeast   256 LLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQ 320

  Fly   185 ITLQLDRMISTTE-------------------------NMYTDYLANG--DRSEAMAKLRVPPLG 222
            :..|..:.|::::                         ..:|..|.|.  ||.....||:...:.
Yeast   321 LVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQ 385

  Fly   223 HPTPP----------VHVFSAGLFLGLFLVSAILCFISYFAVDTSPEFRYTFVSLFRGPISG--- 274
            :....          |.:...||.:|:.:  .::.:..|..: :|.|..:|...||  |:.|   
Yeast   386 YSISEQMVHRNNRSIVQMLVVGLGIGVSM--TLITYTLYLGI-SSEETSFTHKILF--PLWGGWY 445

  Fly   275 --VTFGFCLAINIKVYETVGVNQ--VLIFEVERRNAIGAMR----------ALEISSFFGYMCTL 325
              :...|...:|..::...|:|.  :::.|::.:|......          .|...:||...|.:
Yeast   446 MVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAV 510

  Fly   326 SILLYLLHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRI-----WLLTVMGRILLSPFFF 385
            ..:|     .|.:|....:..:.:..|..|||.|..::.|..::     ||:..:.|:::|.||.
Yeast   511 CSML-----SFALEKLTPLGFLYIGIVSFLFLCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFP 570

  Fly   386 VNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFEPDYAVAVIRCLPAWFRFAQSLR 450
            |.|.||::.|...||..:|.|   :..|:..|....::........|:.|:.|||:::||.|.||
Yeast   571 VEFGDFFLGDIICSLTYSIAD---IAMFFCVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLR 632

  Fly   451 RFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHY--TDLFESPWTWAYITICIVSSIYTV 513
            ||.|||. ...:|:||.||.|.||       ...|:..|  :|..|...| .:|....::||.|.
Yeast   633 RFADSGD-WFPHLLNAAKYTLGIA-------YNATLCAYRLSDRSEQRRT-PFIVCATLNSILTS 688

  Fly   514 FWDLLMDFGLFRVWNGENKFLRDNLVY---PRW-----------FYYFVIVENTLLRCVWILEFA 564
            .|||:||:.........|..|||:|..   ..|           .|||.::.:.|:|..||: :|
Yeast   689 AWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIV-YA 752

  Fly   565 LVHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRD 612
            :..|.:........::...|:.|||.|...|:||||:.|...||.|.|
Yeast   753 IAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGD 800

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 56/294 (19%)
SPX 3..163 CDD:281146 55/293 (19%)
EXS 267..601 CDD:281164 102/372 (27%)
SYG1NP_012217.3 COG5408 1..310 CDD:227695 61/314 (19%)
SPX_SYG1_like 2..291 CDD:269896 56/294 (19%)
SPX 2..98 CDD:271919 21/96 (22%)
COG5409 402..803 CDD:227696 114/423 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I800
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T634664
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.870

Return to query results.
Submit another query.