DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and ERD1

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_010702.4 Gene:ERD1 SGDID:S000002822 Length:362 Species:Saccharomyces cerevisiae

Alignment Length:440 Identity:96/441 (22%)
Similarity:163/441 (37%) Gaps:113/441 (26%)


  Fly   189 LDRMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFA 253
            :::..|.:|.:|...:.|                  .||...|...:.|.|::.:.||.|..:..
Yeast     1 MEKSESNSEGLYLQNILN------------------VPPPQRFIVLIILALWIWTWILKFFLHSN 47

  Fly   254 VDTSP--------EFR--YTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIG 308
            :|.|.        :.|  ||...|.|     ....|.|.|. ::........|.:||.       
Yeast    48 LDVSQVILTRVPHDIRPGYTLQQLHR-----TARNFALKIT-RIIIPFHFATVFLFEF------- 99

  Fly   309 AMRALEISSFFGYMCTLSILLYLLHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLLT 373
             |..:|     |.:..:.:::|            ::||:|...:....|...:|:.|..|..|| 
Yeast   100 -MNIIE-----GPLKNIILIVY------------FLPLIQCVTIFWFLLKECQIIKYCTRRCLL- 145

  Fly   374 VMGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFEP----DYAVA 434
                |..||....| ....::|..||....::|.........|           ||    |.:||
Yeast   146 ----IESSPRSLRN-TYILISDTLTSFAKPLIDFTLFTSLIFR-----------EPFTHFDLSVA 194

  Fly   435 VIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKY-----FLFI---AEVVFSTIQMETIAHYTD 491
            :   ||...|..|.||.:|  .......|.|||||     .||.   :.|...:|..|.:.|...
Yeast   195 L---LPVLVRLLQCLREYR--LLHEATLLFNALKYSCNLPILFCTWRSRVYEGSINEERLHHVQR 254

  Fly   492 LFESPWTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYPRWFYYFVIVENTLLR 556
            .|           .:::|.||:|||:.||:.|..:.:..:: .:..:...:..|:..|:.:.|||
Yeast   255 WF-----------MLINSSYTLFWDVRMDWSLDSLTSLRSR-SKSAVTLKKKMYHSAILVDFLLR 307

  Fly   557 CVWILEFALVHQELIAP------YNGKSLICFSEIARRFFWNFLRLENEH 600
            ..|:..:...:.:|:|.      :.|:  :.:.|:.||..|...:|:.|:
Yeast   308 FWWLWVYLSQNLKLVAADSDYIFFQGE--MQYFEVIRRGIWVVFKLDAEY 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898
SPX 3..163 CDD:281146
EXS 267..601 CDD:281164 79/353 (22%)
ERD1NP_010702.4 COG5409 1..362 CDD:227696 96/441 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.