DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and VTC2

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_116651.1 Gene:VTC2 SGDID:S000001890 Length:828 Species:Saccharomyces cerevisiae

Alignment Length:194 Identity:53/195 (27%)
Similarity:70/195 (36%) Gaps:49/195 (25%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |.||..|.|.:.|.|:..|:||..||:.:     |..|....|||....:..:.|..|......|
Yeast     1 MLFGVKLANEVYPPWKGSYINYEGLKKFL-----KEDSVKDGSNDKKARWDDSDESKFVEELDKE 60

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKL- 129
            |.||..|...|......:|:.|..|.|...|                             ||.| 
Yeast    61 LEKVYGFQLKKYNNLMERLSHLEKQTDTEAA-----------------------------IKALD 96

  Fly   130 ----RLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKY-VLKSTLAITLQ 188
                :..:.|.......|.|::.||.|.|.||.||:||         .|.|| .:||.|.:.|:
Yeast    97 ADAFQRVLEELLSESTELDNFKRLNFTGFAKIVKKHDK---------LYPKYPSVKSLLEVRLK 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 44/166 (27%)
SPX 3..163 CDD:281146 44/165 (27%)
EXS 267..601 CDD:281164
VTC2NP_116651.1 COG5036 1..555 CDD:227369 53/195 (27%)
SPX_VTC2_like 2..134 CDD:269901 44/166 (27%)
PolyPPase_VTC2-3_like 197..547 CDD:143630
VTC1 662..791 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116276697
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.