powered by:
Protein Alignment CG10481 and VTC2
DIOPT Version :9
| Sequence 1: | NP_995731.1 |
Gene: | CG10481 / 35273 |
FlyBaseID: | FBgn0032827 |
Length: | 646 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_116651.1 |
Gene: | VTC2 / 850544 |
SGDID: | S000001890 |
Length: | 828 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 194 |
Identity: | 53/194 - (27%) |
| Similarity: | 70/194 - (36%) |
Gaps: | 49/194 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
|.||..|.|.:.|.|:..|:||..||:.: |..|....|||....:..:.|..|......|
Yeast 1 MLFGVKLANEVYPPWKGSYINYEGLKKFL-----KEDSVKDGSNDKKARWDDSDESKFVEELDKE 60
Fly 66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKL- 129
|.||..|...|......:|:.|..|.|...| ||.|
Yeast 61 LEKVYGFQLKKYNNLMERLSHLEKQTDTEAA-----------------------------IKALD 96
Fly 130 ----RLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKY-VLKSTLAITLQ 188
:..:.|.......|.|::.||.|.|.||.||:|| .|.|| .:||.|.:.|:
Yeast 97 ADAFQRVLEELLSESTELDNFKRLNFTGFAKIVKKHDK---------LYPKYPSVKSLLEVRLK 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C157343546 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
1 |
0.950 |
- |
0.569298 |
Normalized mean entropy |
S1995 |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.790 |
|
Return to query results.
Submit another query.