DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT1G69480

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001320450.1 Gene:AT1G69480 AraportID:AT1G69480 Length:777 Species:Arabidopsis thaliana

Alignment Length:805 Identity:198/806 (25%)
Similarity:308/806 (38%) Gaps:236/806 (29%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIR---------------------NAVEKAPSG----- 39
            |||||.....|||||...|::||.||::::                     .|:.::.||     
plant     1 MKFGKIFKKQMVPEWVEAYVDYNGLKRVLKEIRSYKHSKLTRAASRVSQQAEALHRSFSGLSFHP 65

  Fly    40 --SRPSNDVAIGYYR-------------------------NFEELFFNSCRVELTKVNYFFAHKQ 77
              |..:.|:.....:                         .|||.||......|.|||.|:..|.
plant    66 RHSERAGDIEDQVIKVDTVQEEGSRKLYETKFLKKSEEGGEFEESFFKKLDENLNKVNKFYRDKV 130

  Fly    78 AEAHRKLATLNYQLDR----RRAQQDP--------------------RGSTASRGSASS------ 112
            .|...:.|.|:.|:|.    |...|.|                    ..:..::|:|::      
plant   131 KEVIEEAALLDKQMDALIALRVKMQKPDVDNLNLEKHPSDKVVVDTSDNTMRTQGTANTDMVHGI 195

  Fly   113 ---------------------------------------------------------------WS 114
                                                                           .|
plant   196 ERTNIPEEEASHIMADIVPVSHTNGDEEEASIGDKQDLREILERVKMNDVLESPITTLKGVFGDS 260

  Fly   115 RQPEGKRKFPPIKK----LRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYE 175
            .:|..|:   .:||    |||..||||..|..|:.|..:|:.||.||.|||:| :.|......|.
plant   261 NEPISKK---GLKKGEEQLRLVFSEFYQKLRRLKEYSFMNLLAFSKIMKKYEK-IASRNASRNYM 321

  Fly   176 KYVLKSTLAITLQLDRMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLG-- 238
            |.|..|.:..:.:::|::...|..:..:.::|:|.|.|..|| |.:......|..|| |.|.|  
plant   322 KIVDNSLIGSSDEVNRLLERVEVTFVKHFSSGNRREGMKCLR-PKVKRERHRVTFFS-GFFSGCS 384

  Fly   239 LFLVSAILCFISYFAVDT--------SPEFRYTFVSLFRGPISGVTFGFCL------AINIKVYE 289
            :.||.|::     |.:::        ..|:....:.|:.      .|||.:      :.||..::
plant   385 IALVIAVV-----FKIESRKIMEKNYGTEYMANIIPLYS------LFGFIILHMLMYSANIYFWK 438

  Fly   290 TVGVNQVLIFEVERRNAIGAMRALEISSFFGYMCTLSILLYLL---------HKEFFIEDPIYIP 345
            ...||...||..::...:|......:|:....:..:..||.|.         ||..    |..||
plant   439 RYRVNYTFIFGFKQGTELGDREVFLVSTGLAVLAFVCFLLNLQLDMDWRMKHHKTL----PEVIP 499

  Fly   346 LVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYL 410
            |.....|:.:...||.|::.|.|.:.:..:...:.:|.:.|...||::.|..||.:..|......
plant   500 LCLATIVLFILFCPFNIIYRSSRFFFIRSLFHCICAPLYEVTLPDFFLGDHLTSQIQAIRSFELF 564

  Fly   411 VRFY-VRYFLDRS---------DAFEFEPDYAVAVIRCLPAWFRFAQSLRRFRDSGSKSTDYLIN 465
            :.:| :..:|.|.         :||.|       |:..:|.|.||.|.:||..:  .|.:.:..|
plant   565 ICYYGLGEYLQRQNKCHSHGVYNAFYF-------VVAVIPYWLRFLQCIRRLCE--EKESVHGYN 620

  Fly   466 ALKYFLFIAEVVFSTIQMETIAHYTDLFESPWTWAYITICIVSSIYT---VFWDLLMDFGLFRVW 527
            ||||.|.|..|:..|...         .:...||..:.: :.|.:.|   .|||:::|:||.|. 
plant   621 ALKYMLTIIAVIVRTAYE---------LKKGRTWMILAL-VSSGVATGMNTFWDIVIDWGLLRK- 674

  Fly   528 NGENKFLRDNLVYPRWFYYF-VIVENTLLRCVW---ILEFALVHQELIAPYNGKSLICFSEIARR 588
            :.:|.:|||.|:.|....|| .:|.|.:||..|   :|||.|.....||.   .|:|...||.||
plant   675 HSKNPYLRDKLLVPHKSVYFAAMVVNVILRVAWMQLVLEFNLKSLHKIAV---TSIISCLEIIRR 736

  Fly   589 FFWNFLRLENEHLYNCGQFRATRDI 613
            ..|:|.|||||||.|.|::||.:.:
plant   737 GIWSFFRLENEHLNNVGKYRAFKSV 761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 63/311 (20%)
SPX 3..163 CDD:281146 62/310 (20%)
EXS 267..601 CDD:281164 103/366 (28%)
AT1G69480NP_001320450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.