DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT1G35350

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_174768.2 Gene:AT1G35350 AraportID:AT1G35350 Length:751 Species:Arabidopsis thaliana

Alignment Length:782 Identity:207/783 (26%)
Similarity:327/783 (42%) Gaps:191/783 (24%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIR------------NAVEKAPSGSRPSNDVAIGYYRN 53
            |||||.....|:|||:..||:|..||.::|            ..:::..||.|..:.:...|.|.
plant     1 MKFGKEYVAQMIPEWQQAYMDYTCLKTILREIKTSQKRSESQGVLKRKLSGRRNFSGLTKRYSRT 65

  Fly    54 F--------------------------------------EELFFNSCRVELTKVNYFFAHKQAEA 80
            |                                      |.:||.:..:|..|||.|:.....|.
plant    66 FSSRDLENHDIMVHATTGDDGFEKYETTILKVSEVGRESELVFFKTLDLEFDKVNRFYRSNVEEL 130

  Fly    81 HRKLATLNYQLDRRRA--------------------------QQDPRGST------------ASR 107
            .::...||.|:|...|                          .::.:|.|            .|.
plant   131 VKEAVVLNRQMDALIAYRIKLDQPSTSWSCSETVSVDINALDSKEQKGKTLAEEMGIKVEENVSN 195

  Fly   108 GSASSWSRQPE----------GKRKFPPIKKLR--LAMS------------------------EF 136
            |..|:....||          .|.:..|:..:|  |.:|                        ||
plant   196 GGDSTKETAPEALSVLDRIRLNKNQENPLSTIRNVLKLSNKEDIKFTKENLKKIEERLKNVFIEF 260

  Fly   137 YLSLIMLQNYQTLNMTAFRKICKKYDK-NLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTENMY 200
            |..|..|:||..||..|..||.||||| .|::.|..  |.:.|.||.|..:.::::::...|:::
plant   261 YRKLRHLKNYSFLNTLAISKIMKKYDKIALRNAAKL--YMEMVDKSYLTSSDEINKLMLRVESIF 323

  Fly   201 TDYLANGDRSEAMAKLRVPPLGHPTPPVH--VFSAGLFLG--LFLVSAILCFISYFAVDTSPEFR 261
            .::.|..:||:.|..|| |.:   |...|  .||.|.|:|  :.||.|:..||....:..:...:
plant   324 VEHFAGSNRSKGMNLLR-PKV---TKEKHRITFSTGFFVGCTVSLVIALGLFIHARNIMGAVGHK 384

  Fly   262 YTFVSLFRGPISGVTFGFCL------AINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFG 320
            ....::|  |:..: |.|.:      |.||..::...||...||..:....:|....|.:|  ||
plant   385 LYMETMF--PLYSL-FAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYGHVLLLS--FG 444

  Fly   321 YMCTLSILLYLLHKEFFIEDP---------IYIPLVQVAFVVVLFLNPFRILFYSGRIWLLTVMG 376
             :.||::...|::.:..: ||         ..:||..||.|:.:.:.||.|.:.|.|.:.|.|:.
plant   445 -LGTLALCAVLVNMDMEM-DPNTNDYKTITELVPLFVVALVIAISVCPFNIFYRSSRFFFLMVLF 507

  Fly   377 RILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRY-----FLDRSDAFEFEPDYAV--A 434
            |.:.:|.:.||..||::|||.||.|..:..    :.||:.|     |..|....:....|:.  .
plant   508 RCIAAPLYKVNLPDFFLADQLTSQVQALRS----LEFYICYYGWGDFKQRQSTCKSSDVYSTFYF 568

  Fly   435 VIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPWTW 499
            ::..:|.|.||.|.:||..:....|..:  |||||.|.|..|...|  ..:|....|...:.|.:
plant   569 IVAVIPYWSRFLQCVRRLIEEKDVSQGF--NALKYLLTIVAVCLRT--AFSINRGNDWKIAAWVF 629

  Fly   500 AYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYP-RWFYYFVIVENTLLRCVW---I 560
            :.:     ::.|..:||::.|:||..  .....:||:.|:.| :..||..:|.|.:||..|   :
plant   630 SGL-----ATFYGTYWDIVYDWGLLH--RPSKSWLREKLLVPHKSVYYVAMVVNVVLRLAWLQTV 687

  Fly   561 LEF--ALVHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDIFIT-RLDPQE 622
            |:|  :.:|:|.:.     :||...||.||..|||.|||||||.|.|:|||.:.:.:. ..|.:|
plant   688 LDFNISFLHRETMV-----ALIAILEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPLPFNYDEEE 747

  Fly   623 ER 624
            :|
plant   748 DR 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 62/285 (22%)
SPX 3..163 CDD:281146 61/284 (21%)
EXS 267..601 CDD:281164 107/362 (30%)
AT1G35350NP_174768.2 SPX_PHO1_like 2..295 CDD:269897 65/293 (22%)
SPX 3..300 CDD:281146 65/299 (22%)
EXS 391..725 CDD:281164 107/361 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.