DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT1G26730

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_173995.1 Gene:AT1G26730 AraportID:AT1G26730 Length:750 Species:Arabidopsis thaliana

Alignment Length:775 Identity:203/776 (26%)
Similarity:318/776 (41%) Gaps:201/776 (26%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIR------------NAVEKAPSGSRPSNDVAIGYYR- 52
            |||||.....|:|||:..||:|..||.:::            ..:::..||||..:.:...|.| 
plant     1 MKFGKDFVRQMIPEWQQAYMDYAGLKSILQEIQTSRKRSERPGILKRKLSGSRNFSGLTKRYSRT 65

  Fly    53 --------------------NFE----------------EL-FFNSCRVELTKVNYFFAHKQAEA 80
                                .||                || ||.:..:|..|||:|:..|..|.
plant    66 ASTREPEIQDILVHATTGDDGFERYETTILEVAEAGRESELAFFKTLDLEFDKVNHFYRSKVEEM 130

  Fly    81 HRKLATLNYQLDRRRA--------------------------QQDPRGSTA-----------SRG 108
            .::...||.|:|...|                          ..|.|.:.|           |.|
plant   131 VKEAVVLNKQMDALIAFRIKVERPSSSWSCSETVSVDMNALDSNDQRNTLAEEMGIRVEGNGSNG 195

  Fly   109 SASSWSRQPE----------GKRKFPPI--------------------------KKLRLAMSEFY 137
            ..|:....|:          .|.:..|:                          ::|:....|||
plant   196 GDSTKESVPQVLSVLERIRLNKTQETPLSTIKNVLKLSNQEELKFTRENLKKIEERLKNVFIEFY 260

  Fly   138 LSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTENMYTD 202
            ..|..|:||..||..|..||.||||| :.|.:....|.:.|.||.|..:.::::::...|:.:.:
plant   261 RKLRHLKNYSFLNTLAISKIMKKYDK-IASRSAAKPYMEMVDKSYLTSSDEINKLMLRVESTFVE 324

  Fly   203 YLANGDRSEAMAKLRVPPLGHPTPPVH------VFSAGLFLG--LFLVSAILCFISYFAVDTSPE 259
            :.|..:||:.|..||        |.|.      .||.|.|:|  :.||.|::.||....:..:..
plant   325 HFAGLNRSKGMNLLR--------PKVKKEKHRITFSTGFFVGCTVSLVVALVMFIHARNIMGAVG 381

  Fly   260 FRYTFVSLFRGPISGVTFGFCL------AINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSF 318
            .:....::|  |:..: |.|.:      |.||..::...||...||..:....:|....|.:|  
plant   382 HKVYMETMF--PLYSL-FAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYRHVLLLS-- 441

  Fly   319 FGYMCTLSILLYLLHKEFFIEDP---------IYIPLVQVAFVVVLFLNPFRILFYSGRIWLLTV 374
            || :.||::...|::.:..: ||         ..:|:..:|.||.:...||.|.:.|.|::.|.|
plant   442 FG-LGTLALCAVLINLDMEM-DPNTNDYKTMTELLPMFILALVVAILFCPFNIFYRSSRVFFLMV 504

  Fly   375 MGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRY-----FLDRSDAFEFEPDYAV- 433
            :.|.:.:|.:.||..||::|||.||.|..:..    :.||:.|     |..|.:.......|:. 
plant   505 VFRCIAAPLYKVNLPDFFLADQLTSQVQALRS----LEFYICYYGWGDFKHRQNTCRSSDVYSTF 565

  Fly   434 -AVIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPW 497
             .::..:|.|.||.|.:||..:....|..|  |||||.|.:..|...|.       |:....:.|
plant   566 YFIVAVIPYWSRFLQCVRRLIEENDSSQGY--NALKYLLTVVAVCLRTA-------YSFNRGNIW 621

  Fly   498 ---TWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYP-RWFYYFVIVENTLLRCV 558
               .|.:..:   ::.|..:||::.|:||..  ......||:.|:.| :..||..||.|.:||..
plant   622 KISAWVFSAL---ATFYGTYWDIVFDWGLLH--RPSKHLLREKLLVPHKAVYYVAIVLNIVLRMA 681

  Fly   559 W---ILEFAL--VHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDI 613
            |   :|:|.|  :|:|.:.     :|:...||.||..|||.|||||||.|.|:|||.:.:
plant   682 WLQTVLDFNLSFLHRETMI-----ALLAALEIIRRGIWNFFRLENEHLNNVGKFRAFKSV 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 63/284 (22%)
SPX 3..163 CDD:281146 62/283 (22%)
EXS 267..601 CDD:281164 107/365 (29%)
AT1G26730NP_173995.1 SPX_PHO1_like 2..294 CDD:269897 65/293 (22%)
SPX 3..299 CDD:281146 65/297 (22%)
SPX <212..286 CDD:271919 19/74 (26%)
EXS 390..724 CDD:281164 107/364 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.