DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT1G14040

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_172857.2 Gene:AT1G14040 AraportID:AT1G14040 Length:813 Species:Arabidopsis thaliana

Alignment Length:837 Identity:204/838 (24%)
Similarity:308/838 (37%) Gaps:262/838 (31%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAV------EKAPS--------------------- 38
            |||||...:.|||||:..||:|:.||.:::..:      ..|||                     
plant     1 MKFGKEFSSQMVPEWQQAYMDYDFLKTLLKEIITFKRRTNNAPSHGGAKTGGGLNRKLTLYRAFS 65

  Fly    39 ------------------------GSRPSNDVAI------GYYRNF----------EELFFNSCR 63
                                    ||..|..:.:      ||...|          |.:||....
plant    66 GLVSTPRHKRSNSSHDVEEGVQLTGSMRSGPILVNTTASHGYETTFLMAAEEGGEYELVFFRRLD 130

  Fly    64 VELTKVNYFFAHKQAEAHRKLATLNYQLDR----RRAQQDPRG---------------------- 102
            .|..||:.|:..|..|..::.|.||.|:|.    |...::|.|                      
plant   131 DEFNKVDKFYRKKVEEVLKEAAMLNKQMDALIAFRVKVENPDGWRWEERTVEMTRLASDIATSAA 195

  Fly   103 ---------------------------------------------------STASRGSASSWSRQ 116
                                                               ||.:..:.::.||.
plant   196 ALSASTPAGAKSMKVRSQEHMEAIQEGGSSRAGLMEDDEEDEDEQNETSVVSTGAIDNETTTSRM 260

  Fly   117 PEGKRKFP------------------PIK-----------------------KLRLAMSEFYLSL 140
             .|.|..|                  .||                       .|:.|..|||..|
plant   261 -RGARPSPIDVLGRVKINNTKETPRSTIKGVLKVSKQTDLKFSRENLMKVEESLKRAFIEFYQKL 324

  Fly   141 IMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTENMYTDYLA 205
            .:|::|..||:.||.||.||||| :.|......|.|.|..|.|..:.::.|::...|..:..:.|
plant   325 RLLKSYSFLNVLAFSKILKKYDK-ITSRDATKPYMKVVDSSYLGSSDEVMRLMERVEATFIKHFA 388

  Fly   206 NGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLG--LFLVSAILCFI---SYFAVDTSPEFRYTFV 265
            |.:|::||..||  |..........||.|...|  ..|:.|::..|   :...::...|:..|..
plant   389 NANRAKAMNILR--PKAKRERHRITFSTGFSAGCVFSLIVALVAIIRTRNLLEMEGQKEYMNTMF 451

  Fly   266 SLFRGPISGVTFGFCL------AINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGYMCT 324
            .|:.      .|||.:      |.||..:....||...||..::...:|..:.|.:....|.:..
plant   452 PLYS------LFGFIVLHIIVYAANIYYWRRYRVNYSFIFGFKQGTELGYRQVLLVGFSIGVLAL 510

  Fly   325 LSILLYL------LHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSPF 383
            |.:|..|      ..|.:.....| :||:.:|.:.::.:.||...:.|.|.:.||.:...|.:|.
plant   511 LCVLANLDMEADPKTKAYQARTEI-LPLILLAAMFIVLVLPFNYFYRSSRFFFLTCLFHCLAAPL 574

  Fly   384 FFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYF-----------LDRSDAFE--FEPDYAVAV 435
            :.|...||::.||.||.|..|..    :.||:.|:           ...||.:.  |   :.|||
plant   575 YKVTLPDFFLGDQLTSQVQAIRS----IEFYICYYGWGDFRHRKSTCKESDVYNTFF---FIVAV 632

  Fly   436 IRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFST---IQMETIAHYTDLFESPW 497
            |   |...|..|.|||..:..:....|  |.|||||.|..|...|   ||...:|         |
plant   633 I---PYVSRLLQCLRRLFEEKNPEQGY--NGLKYFLTIVAVCLRTAYSIQKGQVA---------W 683

  Fly   498 TWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYPRWFYYFV-IVENTLLRCVWI- 560
            .........:::|:..:||.:.|:||.. ...:|::|||.|:.|:...||: :|.|.|||..|| 
plant   684 RVLAAVFSFIAAIFCTYWDFVHDWGLLN-RTSKNRWLRDKLLVPQKKVYFIAMVLNVLLRFAWIQ 747

  Fly   561 ----LEFALVHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDI 613
                ..|:.:|::.:.     :::...||.||..|||.|||||||.|.|::||.:.:
plant   748 TVLDFNFSFMHRQTMV-----AIVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKSV 799

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 67/346 (19%)
SPX 3..163 CDD:281146 66/345 (19%)
EXS 267..601 CDD:281164 105/368 (29%)
AT1G14040NP_172857.2 SPX_PHO1_like 2..355 CDD:269897 69/355 (19%)
SPX 3..360 CDD:281146 70/359 (19%)
SPX <284..347 CDD:271919 20/63 (32%)
EXS 451..787 CDD:281164 105/370 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.