DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and SPX4

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001330175.1 Gene:SPX4 AraportID:AT5G15330 Length:387 Species:Arabidopsis thaliana

Alignment Length:232 Identity:52/233 (22%)
Similarity:89/233 (38%) Gaps:59/233 (25%)


  Fly     1 MKFGKTLDNLM---VPEWRYQYMNYNELKQMIR---------------------------NAVEK 35
            |||||.....:   :||||.:::.|..||::::                           |....
plant    70 MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTTNISSA 134

  Fly    36 APSGS-----RPSNDVAIGYYRNFEELFFNSCRVELTKVNYFFAHKQAEAHRKLATLNYQLDRRR 95
            |..|.     |||.|:...:.|...:        ||.|.|.|:..|:.:...:|..|..::::  
plant   135 ADDGGVVPGVRPSEDLQGSFVRILND--------ELEKFNDFYVDKEEDFVIRLQELKERIEQ-- 189

  Fly    96 AQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKK 160
             .::..|..||.   |.:|.:         :..:|..:...:..:::|:||.:||.....||.||
plant   190 -VKEKNGEFASE---SEFSEE---------MMDIRRDLVTIHGEMVLLKNYSSLNFAGLVKILKK 241

  Fly   161 YDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTE 197
            |||......... :.:.||......|..|.|::...|
plant   242 YDKRTGGLLRLP-FTQLVLHQPFFTTEPLTRLVRECE 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 44/196 (22%)
SPX 3..163 CDD:281146 43/195 (22%)
EXS 267..601 CDD:281164
SPX4NP_001330175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
10.910

Return to query results.
Submit another query.