DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and SHB1

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_194265.2 Gene:SHB1 AraportID:AT4G25350 Length:745 Species:Arabidopsis thaliana

Alignment Length:774 Identity:209/775 (27%)
Similarity:323/775 (42%) Gaps:205/775 (26%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELK------QMIRNAVEKAPSGSRPS---------------- 43
            |:|||...:.|:|||:..|::|..||      |..||..:.....|.||                
plant     1 MRFGKEFVSQMIPEWQEAYIDYAYLKTILQDIQASRNRSDSNNQSSTPSFARNLTRRYNRDALVS 65

  Fly    44 --NDVAIGYYR-----------------------NFEELFFNSCRVELTKVNYFFAHKQAEAHRK 83
              :|:.:....                       :||..||.:...|..|||.|:..|...|..:
plant    66 ENHDIVVNTVTRLEEGLETAAYETTFLKAGEAGGDFEVTFFRTLDREFNKVNNFYRLKVETARTE 130

  Fly    84 LATLNYQLDRRRA-------------------QQDPRGSTASRGSASSWSR-------------- 115
            ...||.|:|...|                   .:|..||.:..||:|..:.              
plant   131 ALALNKQMDALIAFRHKVMDQNQKNPSVFDSVSEDINGSASEVGSSSKCTEHNVALADLMRNEDT 195

  Fly   116 ---------QPEGKRKFPPI--------------------------KKLRLAMSEFYLSLIMLQN 145
                     :....|:..|:                          |:|::|..|||..|..|:|
plant   196 SNESILERIRMNKTREITPLSAIKTILKVHKQDELKFTRDNLKEVEKRLQVAFIEFYQKLRHLKN 260

  Fly   146 YQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTENMYTDYLANGDRS 210
            |..||.:|..||.|||||..|..|. ..|.:.|.||.|:.:.::.:::...|:::.::.:|.:|.
plant   261 YSFLNASAVSKIMKKYDKIAKRNAA-KLYMEMVDKSFLSSSEEVHKLLLKVESIFIEHFSNSNRR 324

  Fly   211 EAMAKLRVPPLGHPTPPVH------VFSAGLFL--GLFLVSAILCFISYFAVDTSP---EFRYTF 264
            |.|:.||        |.::      .||.|.|.  |:.|:.|:...|....:..:|   .:..|.
plant   325 EGMSHLR--------PKINKERHLITFSTGFFFGCGISLIVALGLIIHARNIMGTPGQRTYMETM 381

  Fly   265 VSLFRGPISGVTFGFCL------AINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGYMC 323
            ..|:|      .|||.:      |.||..:....||...||..::...:|....|.:|  || :.
plant   382 FPLYR------FFGFVVLHMDVYAANIYFWRRYRVNYSFIFGFKQGTELGYRHVLLLS--FG-LG 437

  Fly   324 TLSILLYLLH---------KEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRIL 379
            |||:...||:         |::.:...: |||..:..|:::.|.||.||:.|.|.:.|:|:.|.:
plant   438 TLSLCAVLLNLDMEMDAQTKDYRLVTEL-IPLFLLVLVIIIVLCPFNILYRSSRFFFLSVLFRCI 501

  Fly   380 LSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRY-----FLDR-----SDAFEFEPDYAVA 434
            .:||:.|:..||::.||.||.|..:..    :.||:.|     |..|     :....|...|.:.
plant   502 AAPFYAVHLPDFFLGDQLTSQVQALRS----LEFYICYYGFGDFRYRRRNTCTSNIGFRTFYFIV 562

  Fly   435 VIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPW-- 497
            .:  :|.|.||.|.:||..:....|..|  |.:||.|.|......|.       ||....|.|  
plant   563 AV--IPYWLRFLQCIRRMVEDRDLSHGY--NGIKYLLTIVAASLRTA-------YTLNRGSNWNI 616

  Fly   498 -TWAYITICIVSSIYTVFWDLLMDFGLFRVWNG-ENKFLRDNLVYP-RWFYYFVIVENTLLRCVW 559
             .|.:..   |::.|..:||:::|:||.:  .| :|.||||.|:.| :..||..:|.|.|||.||
plant   617 TAWVFSG---VATFYGTYWDIVLDWGLLQ--RGCKNSFLRDKLLVPHKTVYYAAMVLNVLLRLVW 676

  Fly   560 I-----LEFALVHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDI 613
            :     |:|:.:|:|.:.     :|:...||.||..|||.|||||||.|.|::||.:.:
plant   677 LQTVLDLKFSFLHRETMV-----ALMACLEIIRRGIWNFFRLENEHLNNVGRYRAFKTV 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 61/276 (22%)
SPX 3..163 CDD:281146 61/275 (22%)
EXS 267..601 CDD:281164 116/369 (31%)
SHB1NP_194265.2 SPX_PHO1_like 2..286 CDD:269897 64/285 (22%)
SPX 3..291 CDD:281146 65/289 (22%)
EXS 382..718 CDD:281164 116/371 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.