DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT2G03260

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_178425.2 Gene:AT2G03260 AraportID:AT2G03260 Length:807 Species:Arabidopsis thaliana

Alignment Length:824 Identity:207/825 (25%)
Similarity:329/825 (40%) Gaps:242/825 (29%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVE---------------------------KAPS 38
            |||||.|.:.||.||:..|:||:.||.:::..::                           :|.|
plant     1 MKFGKELSSQMVQEWQQAYVNYDYLKTLLKEIIKLKEKTNPPPPPHHAVPGEGISRKMTLYRAFS 65

  Fly    39 G-----------SRPSN-----DVAIG----------------YYRNFEE------LFFNSCRVE 65
            |           ||.||     |:..|                :....||      :||.....|
plant    66 GLVQTPGKKRQSSRQSNYSSEIDIEEGKAPILVSKSTHGLETTFLMTAEEGGEYELVFFRRLDDE 130

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDR----RRAQQDPRG-------------------STASR 107
            ..:|..|:..|..|..:....||.|:|.    |...::|.|                   |||:.
plant   131 FNRVEKFYKEKVEEVMKDAIMLNKQMDALIAFRVKVENPVGWGWEERTVEMTRLASDIATSTAAI 195

  Fly   108 GSAS---------------------SWSRQPE-----------------------GKRKFP---- 124
            .:::                     |:||:.|                       |.|..|    
plant   196 AASTPARTRTMNPRAQAHMEAIQEGSFSRENEDEDHGSVRGATGDVKTSSLNTMRGARPAPIEVL 260

  Fly   125 --------------PIK-----------------------KLRLAMSEFYLSLIMLQNYQTLNMT 152
                          .||                       ||:.|..|||..|.:|::|..||:.
plant   261 DHIKINNTKATPRSTIKGVLNSSSQNEIIFNRQNLNEVEEKLKFAFVEFYQKLRLLKSYSFLNVL 325

  Fly   153 AFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTENMYTDYLANGDRSEAMAKLR 217
            ||.||.||||| :.|......|.|.|..|.|..:.:|.::|...|:.:..:.|||.|.:.|..||
plant   326 AFSKILKKYDK-ITSRNASKSYMKMVDNSYLGSSDELMKLIQRVESTFIKHFANGHRRKGMNILR 389

  Fly   218 VPPLGHPTPPVHVFSAGLFLGLF--LVSAILCFISYFAVDTSPEFRY-TFV-SLFRGPISGVTFG 278
             |.:......| .||.|...|..  |:.|::..|.  ...|.||..: |:: ::|  |:..: ||
plant   390 -PQMKREKHRV-TFSTGFSAGCIFSLIVALVAIIR--TRKTMPEAEHNTYMNTMF--PLYSL-FG 447

  Fly   279 FCL------AINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGY-MCTLSILLYL--LHK 334
            |.:      ||:|..::...||...||..::...:|..:.|    |.|: :.|.::|..|  |..
plant   448 FIVLHITMYAIDIYYWKRYRVNYAFIFGCKQGTELGYRQVL----FLGFTIGTFALLCVLGNLDM 508

  Fly   335 EFFIEDPIYIPLVQ-------VAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSPFFFVNFADFW 392
            |...:...:.||.:       ||..|||.: ||..|:.|.|.:.||.:...|.:|.:.|...||:
plant   509 EVNPKTKNFKPLTELLPLFLLVALFVVLIM-PFHFLYRSTRFFFLTCLLHCLAAPLYKVTLPDFF 572

  Fly   393 VADQWTSLVVTIVDHYYLVRFYVRY-----FLDRSDAFEFEP--DYAVAVIRCLPAWFRFAQSLR 450
            :.||.||.|..:..    :.||:.|     |..|.:..|...  .|::.::..||...|..|.:|
plant   573 LGDQLTSQVQALRS----INFYICYYGWGDFKKRQNTCEASEIYIYSLYIVASLPYLSRLLQCMR 633

  Fly   451 RFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPWTWAYITI-----CIVSSI 510
            |..:  .:|.|...|.:||.|.:..|...|      |:..::..:....:::.:     .|::::
plant   634 RMIE--ERSLDQGYNGVKYLLTVIAVSLRT------AYGYEVKNTKNPTSHLKVLAGSSSILAAV 690

  Fly   511 YTVFWDLLMDFGLFRVWNGENKFLRDNLVYPRWFYYFV-IVENTLLRCVWI-----LEFALVHQE 569
            :..:||.:.|:||... ..:|::|||.|:.|:...||: ::.|.:||..|:     .||..:|::
plant   691 FCTYWDFVHDWGLLNK-TSKNRWLRDKLLIPQKKVYFIAMILNVVLRFAWLQTILNFEFEFLHKQ 754

  Fly   570 LIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDI 613
            ...     :::...||.||..|||.|:|||||.|.|:|||.:.:
plant   755 TTL-----AVVASLEIMRRGMWNFFRVENEHLNNVGKFRAFKSV 793

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 70/334 (21%)
SPX 3..163 CDD:281146 69/333 (21%)
EXS 267..601 CDD:281164 100/368 (27%)
AT2G03260NP_178425.2 SPX_PHO1_like 2..344 CDD:269897 72/343 (21%)
SPX 3..349 CDD:281146 73/347 (21%)
EXS 440..781 CDD:281164 100/367 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.