DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and AT2G03250

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001318190.1 Gene:AT2G03250 AraportID:AT2G03250 Length:719 Species:Arabidopsis thaliana

Alignment Length:761 Identity:167/762 (22%)
Similarity:270/762 (35%) Gaps:234/762 (31%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIR-------------------NAVEKAPSG-----SR 41
            |||||...:    ||:..|::|..||.:::                   :.|.:...|     .:
plant     1 MKFGKDFSS----EWQQAYVDYKYLKTLVKDINRFKRKTNLHGGQISLSSTVLEIEDGITTATIQ 61

  Fly    42 PSNDVAIGYYRNF----------EELFFNSCRVELTKVNYFFAHKQAEAHRKLATLNYQLDR--- 93
            .|:..:..|...|          |.:||.....|..||..|:..|..|..::.|.||.|:|.   
plant    62 VSSTASQRYETTFLMTAEKGGEYELVFFRRLDDEFNKVEKFYREKVDEVVKEAAVLNKQMDALIA 126

  Fly    94 -------------------------------------------------RRAQQD---------- 99
                                                             ||:.:|          
plant   127 FRLKMKEESTVEMARFALHGVVSPAELAKNPSMKVHMEAIEEGGSSRAGRRSDEDDYYTDEEDHN 191

  Fly   100 -----PRGSTASRGSASS-----------------------------------WSRQPEGKRKFP 124
                 |..:.:...|:||                                   :||  :..||..
plant   192 DVFFTPANNLSKMKSSSSAFIEVLDSIKINNTKEALQSNTKSVLKVSNHTELKFSR--DNLRKIE 254

  Fly   125 PIKKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQL 189
              :||..|..||:..|..|::|..||:.|..||..||||....:|..: |.|.|.||.|..:.::
plant   255 --EKLICAFVEFHRKLWYLKSYSFLNVLALSKILTKYDKITSRDAAKS-YMKMVDKSCLGSSDEV 316

  Fly   190 DRMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVH----VFSAGLFLGLFLVSAILCFIS 250
            .:::...|..:.....||:|::.|..||      |.|...    .||.| |||..:.|.|:..::
plant   317 MKLMENVEATFIKQFTNGNRTKGMNILR------PKPKRERHRLTFSTG-FLGGCMFSLIVALVA 374

  Fly   251 YFAV------DTSPEFRYTFVSLFRGPISGVTFGFCL------AINIKVYETVGVNQVLIFEVER 303
            ....      |...::..|...|:.      .|||.:      |.||..:....||...||..::
plant   375 IVRTRNILQDDGQKQYMNTMFPLYS------LFGFIMLHMTMYAANIYFWRQYRVNYSFIFGFKQ 433

  Fly   304 RNAIGAMRALEISSFFGYMCTLSILLYLLHKEFFIEDP---------IYIPLVQVAFVVVLFLNP 359
            ...:|..:.|.:....|.:..|.:|..|..:    .||         ..:||..:..:.|:.:.|
plant   434 GTELGYKQVLFVGFSIGALALLCVLANLDME----TDPKTKDYQALTELLPLFLLIAMFVVLVVP 494

  Fly   360 FRILFYSGRIWLLTVMGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRY-----FL 419
            |.|.:.|.|.:.||.:..:|.:|.:.|...||::|||..|...|:..    :.||:.|     |.
plant   495 FNIFYRSSRFFFLTTLFHMLAAPLYKVTLPDFFLADQLCSQAQTLRS----IEFYICYYGWGDFK 555

  Fly   420 DRS---------DAFEFEPDYAVAVIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAE 475
            .|.         :.|.|       ::...|.:.||.|.:||..:  .|:.:...|..||.:.:..
plant   556 QRKNTCKDSQVFNTFLF-------IVSAFPFFSRFLQCMRRMLE--EKNIEQGYNGFKYIVIVVA 611

  Fly   476 VVFSTIQMETIAHYTDLFESP---WTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDN 537
            |...      :|:..|..:..   |.........::.::..:|||:.|:||.. ...:|.:||||
plant   612 VCLG------MAYEVDDEKDRQIIWRLLGGITSAMAVVFCTYWDLVYDWGLLN-RTSKNPWLRDN 669

  Fly   538 LVYP-RWFYYFVIVE---NTLLR------CVWILEFALVHQELIAP 573
            |:.| :..|...:|.   :|:||      |...|..:..|..|:.|
plant   670 LLIPHKEVYVLAMVSDNISTILRWTTWHGCGRCLAKSWYHLVLLRP 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 56/297 (19%)
SPX 3..163 CDD:281146 55/296 (19%)
EXS 267..601 CDD:281164 83/350 (24%)
AT2G03250NP_001318190.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.