DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and xpr1

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001016753.1 Gene:xpr1 XenbaseID:XB-GENE-1015946 Length:692 Species:Xenopus tropicalis

Alignment Length:677 Identity:245/678 (36%)
Similarity:364/678 (54%) Gaps:74/678 (11%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |||.:.|...:.||||.||:.|...|:|:..|.::|||......|....||..|||:||.:|..|
 Frog     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSIEVTDEDTVKRYYAKFEEIFFQTCEKE 65

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQ----LDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPI 126
            |.|:|.|::.|.|||.|:.|||..:    ||.:|......|....|.:..:.:.:...:.:  .|
 Frog    66 LAKINTFYSEKLAEAQRRSATLQNELQSSLDAQRESSAIPGLRQRRKAVFALTHEERVQHR--NI 128

  Fly   127 KKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDR 191
            |.|:||.||||||||:|||||.||.|.||||.||:||.|::..|..|...:|..:......::::
 Frog   129 KDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYTCKKINQ 193

  Fly   192 MISTTENMYTDYLANGDRSEAMAKLRVPPLG--HPTPPVHVFSAGLFLGLFLV--SAILCFISYF 252
            :||.||.:.|:.|.:|||.:||.:|||||||  .|.|....|..||:.|:|:|  .||:...|::
 Frog   194 LISETETVVTNELESGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGIFIVLNMAIIMAGSHY 258

  Fly   253 AV--DTSPEFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEI 315
            .:  |..|     .|.::||....:.|.|.|.||...:...|||.|||||:..||.:......||
 Frog   259 LLGKDVWP-----MVRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEI 318

  Fly   316 SSFFG-------YMCTLSILLYL-LHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLL 372
            :.|.|       :.|...:.:.| :|..         ||:....:::..:||.:..:|..|.|||
 Frog   319 AGFLGILWCFSLFSCIFGLWINLQMHLN---------PLILYGLMLLFLVNPTKTFYYKSRFWLL 374

  Fly   373 TVMGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFE--------- 428
            .::.|:..:||..|.|||||:|||..||.|.::|..:::.||         :||.:         
 Frog   375 KLLFRVFTAPFHKVGFADFWLADQLNSLAVILMDLEFMICFY---------SFELKWGDSDGLVN 430

  Fly   429 --------PDYAV-AVIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKY----FLFIAEVVFST 480
                    ..|.| ||::|:|||.||.|.|||:||: .::..:|:||.||    |:.....::||
 Frog   431 SANSVCNSYSYGVRAVVQCIPAWLRFIQCLRRYRDT-KRAFPHLVNAGKYSTTFFMVTFAALYST 494

  Fly   481 IQMETIAHYTDLFESPWTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYP-RWF 544
            .:..   :::|.....:.|  |...::||.||:.|||.||:|||....|||.|||:.:||| :.:
 Frog   495 HKER---NHSDAQVFFYLW--IIFYLISSCYTLIWDLKMDWGLFDRNAGENTFLREEIVYPQKAY 554

  Fly   545 YYFVIVENTLLRCVWILEFALVHQELIAPYNG--KSLICFSEIARRFFWNFLRLENEHLYNCGQF 607
            ||..|:::.:||..|.::.::....|......  .:::...|:.|||.|||.|||||||.|||:|
 Frog   555 YYCAIIQDVILRFAWTIQISVTSLNLFTDAGDIISTVLAPLEVFRRFVWNFFRLENEHLNNCGEF 619

  Fly   608 RATRDIFITRLDPQEERFLESVMDNTE 634
            ||.|||.:..|:..::..||.:||..:
 Frog   620 RAVRDISVAPLNADDQTLLEQMMDQDD 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 71/165 (43%)
SPX 3..163 CDD:281146 70/164 (43%)
EXS 267..601 CDD:281164 121/367 (33%)
xpr1NP_001016753.1 SPX_XPR1_like 2..165 CDD:269898 71/165 (43%)
SPX 3..169 CDD:281146 72/168 (43%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 5/7 (71%)
EXS 269..613 CDD:281164 121/368 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.