DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and CG10483

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster

Alignment Length:669 Identity:242/670 (36%)
Similarity:354/670 (53%) Gaps:55/670 (8%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |||.:.|...:.||||.||:||.|:|.|:..|:|::||......::...|:..|:|.||:.|..|
  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQ-PEGKRKFP--PIK 127
            |.|:|.|::.|.|||.||..:|..:|........|:       ...:|.|: |.||:..|  .|:
  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPK-------KLPAWKRRTPLGKKNVPARKIQ 123

  Fly   128 KLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRM 192
            .|:||.|||||.||:|||||.||.|.||||.||:||.|..:.|..|...:|..:.......:||:
  Fly   124 DLKLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRL 188

  Fly   193 ISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFAVDTS 257
            |..||...|..:..|||..||.:|||||||....|...|..|||.|.|:|..|...|:.......
  Fly   189 IQETEQAVTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYGFG 253

  Fly   258 PEFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGYM 322
            ..:| ..:.:||.|...:...|...:|:..:.:.|||.|||||::.||.:.....:|::|.||.:
  Fly   254 ENWR-AGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVI 317

  Fly   323 CTLSILLYLLHKEFFIEDPIYI-----PLVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSP 382
            ....:|.|:..      ||:.|     ||.....:....|||.:...:..|.|.:.::.|::::|
  Fly   318 WACCVLSYIFC------DPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAP 376

  Fly   383 FFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFEPDYAVA------------- 434
            |.||||||||:|||..|:|...:|..:|:.|:.|           .|.:..|             
  Fly   377 FCFVNFADFWLADQLNSMVPAFLDIPFLICFFGR-----------SPTWHKAGKAASHCVEYVSL 430

  Fly   435 ---VIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESP 496
               ::..:||:|||||.:||:||: .:|..:|:||.||......|:|:.....|...|....|:|
  Fly   431 LHPIVAIMPAYFRFAQCIRRYRDT-KESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENP 494

  Fly   497 WTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVY-PRWFYYFVIVENTLLRCVWI 560
            |.:.:||..|.||.|...||:.||:|||....|:|:|||:.:|| ..|||||.|:|:.:||..|.
  Fly   495 WFYCWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWT 559

  Fly   561 LEFALVHQELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDIFITRLDPQEERF 625
            |..:|:....|......:::...|:.|||.||:.|||||||.|.|:|||.|||.:..:|..::..
  Fly   560 LSMSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTT 624

  Fly   626 LESVMDNTEDLGREKLNKK 644
            :..:||.|:.:    ||::
  Fly   625 ILRMMDETDGV----LNRR 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 70/164 (43%)
SPX 3..163 CDD:281146 69/163 (42%)
EXS 267..601 CDD:281164 122/356 (34%)
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 70/164 (43%)
SPX 3..162 CDD:281146 71/166 (43%)
EXS 260..600 CDD:281164 122/358 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152225
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10783
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.