DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and Y39A1A.22

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_499359.3 Gene:Y39A1A.22 WormBaseID:WBGene00012659 Length:710 Species:Caenorhabditis elegans

Alignment Length:710 Identity:233/711 (33%)
Similarity:343/711 (48%) Gaps:107/711 (15%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            ||||:.|.:.:.||||.||::|..||.::.:.:.:.|:    .:|....:....:|.|||.|..|
 Worm     1 MKFGEQLASHLTPEWRKQYIDYERLKNLLYDDMMEVPA----DDDRREEHISRLDEKFFNECDQE 61

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPP----- 125
            |||:|.||:.|.||...|...|..:|   :..:|..|   ||...:...|:..||.||..     
 Worm    62 LTKINLFFSQKIAEGQGKHHELQTEL---QVFKDVLG---SRSDTTGIRRRFGGKDKFHKETTRN 120

  Fly   126 IKKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLD 190
            .::|:||.|||||||:::||:|.||.|.||||.||:||...:|.|..|....|.||:..:..:::
 Worm   121 EQQLKLAFSEFYLSLVLVQNFQQLNATGFRKILKKHDKLTGNERGLDWRINKVEKSSFFLNREIE 185

  Fly   191 RMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFAVD 255
            .:|:..|....:.|..|:|...|.:|:||||.....|:..||.|||:|..::..:...:::.|..
 Worm   186 TLITNVETSVINDLEAGNRQAGMKRLKVPPLSEKQKPLTTFSLGLFIGASIILLLAILLTWIASP 250

  Fly   256 TSP-EFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFF 319
            ..| |.::..|.|||||:......|...:|:..:...|||.||||||:.||.:.....::|:||.
 Worm   251 ARPQEPKWVAVRLFRGPLLLFLSIFLCGVNMAGWAAAGVNHVLIFEVDPRNHLSYQTLMQIASFM 315

  Fly   320 GYMCTLSILLYLLHKEFFIEDPIYIPLVQVAFVVVLFLNPF----RILFYSGRIWLLTVMGRILL 380
            ..:.:.::|.||......| .|...||..:...::|.|||.    .:...:.|.|||....:...
 Worm   316 IMLWSFAVLAYLYAHMLHI-PPFAPPLALMVVCLILLLNPIAKPDSVFHRNSRFWLLKHCYKCFT 379

  Fly   381 SPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFEPDY-------------- 431
            |||.||.|.|||:.||..||....:|..|.|.||..           |.||              
 Worm   380 SPFHFVTFTDFWLGDQMNSLTTAFLDFQYFVCFYAT-----------EVDYSNGWIEVKGINSTT 433

  Fly   432 ------------------AVAVIRCL----PAWFRFAQSLRRFRDSGSKSTDYLINALKY---FL 471
                              :.|.:|.|    ||..||.|.|||:||: .:...:|:||.||   |.
 Worm   434 GSVPWGSVELSNGKDQCASAAGLRSLMSIIPAMIRFLQCLRRYRDT-KRVHPHLVNAGKYSTTFF 497

  Fly   472 FIAEVVFSTIQMETIAHYTDLFESPWTWAYITICIVSSIYTVFWDLLMDFGLF--RVWNGENKFL 534
            .:|....:.....|..:.|.:|...|..:|    |:|..||..||:.||:||.  |. ..|.:||
 Worm   498 VVACGALNKYYEATDPNTTSIFFYIWILSY----IMSFTYTFLWDIFMDWGLIDPRA-PKEARFL 557

  Fly   535 RDNLVY-PRWFYYFVIVENTLLRCVWILEFALVH---------QELIAPYNGKSLICFSEIARRF 589
            |:.::| .:|:||..|.::.:||..|:|..:|..         ..:.||:         |:.|||
 Worm   558 REEMIYGSKWYYYMAIAQDFVLRLAWVLNVSLGEAWTLDSDFLTTVTAPF---------EVFRRF 613

  Fly   590 FWNFLRLENEHLYNCGQFRATRDIFITRLDPQEERFLESV------MDNTEDLGREKLNK 643
            .||:.||||||:.|||||||.|||.:   .|..:..|||:      ||.....|::.:.:
 Worm   614 IWNYFRLENEHVNNCGQFRAVRDISV---KPIRKGDLESLLSKMDQMDGVTHRGQDLMER 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 65/166 (39%)
SPX 3..163 CDD:281146 64/165 (39%)
EXS 267..601 CDD:281164 121/389 (31%)
Y39A1A.22NP_499359.3 SPX_XPR1_like 2..158 CDD:269898 65/166 (39%)
EXS 262..625 CDD:308637 121/390 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.684 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.