DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and CG7536

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster

Alignment Length:641 Identity:270/642 (42%)
Similarity:380/642 (59%) Gaps:18/642 (3%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |||.:.|...:.||||.||:||.|:|.|:..|||:|||.....:||...::.||:|.||:.|..|
  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLR 130
            |.|:|.|::.|.|||.||.||||.:| :...::..|.:..|:|. ...:..|:.|     .::|:
  Fly    66 LKKINTFYSEKLAEATRKFATLNAEL-KTSIEESERSAKKSKGH-KRHAALPDRK-----ARELK 123

  Fly   131 LAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMIST 195
            ||.||||||||:|||||.||.|.||||.||:||.|:.:.|..|.::||..|.......:|.:|:.
  Fly   124 LAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNIINE 188

  Fly   196 TENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFAVDTSPE- 259
            ||...|..|..|||..||.:|||||||....|...|..|||.|.|:|..|:..:|....:.|.| 
  Fly   189 TETTVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVVVVSAIFHEISGEN 253

  Fly   260 FRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGYMCT 324
            .:.|| .|:|||:..:.|.|.:.:||..:.:.|||.|||||::.||.:.....:|:::.||.:.|
  Fly   254 LKVTF-RLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVIWT 317

  Fly   325 LSILLYLLHKEFFIEDPIYIPLVQVAFVVVLFL-NPFRILFYSGRIWLLTVMGRILLSPFFFVNF 388
            ||:|.:|......|  |.:|..:.:..::|||| |||.:|::..|.||..:.||.:.:|||.|.|
  Fly   318 LSMLSFLYSASLAI--PAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGF 380

  Fly   389 ADFWVADQWTSLVVTIVDHYYLVRFYV---RYFLDRSDAFEFEPDYAV-AVIRCLPAWFRFAQSL 449
            ||||:.||..||...|:|..||:.||.   .:...|..:...|.|:.: .::.||||||||||.|
  Fly   381 ADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEARDASICMEKDFIIRPIVNCLPAWFRFAQCL 445

  Fly   450 RRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPWTWAYITICIVSSIYTVF 514
            ||:||| .::..:|:||.||......|:|:|::.....:|...|::|:||.:|...||||.|...
  Fly   446 RRYRDS-REAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYTWLWIIASIVSSCYAYT 509

  Fly   515 WDLLMDFGLFRVWNGENKFLRDNLVY-PRWFYYFVIVENTLLRCVWILEFALVHQELIAPYNGKS 578
            ||:.||:|||....|||.|||:.:|| ...||||.|:|:..||.:|.|.|.|...::::.....|
  Fly   510 WDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLTEMKIVSSDIMTS 574

  Fly   579 LICFSEIARRFFWNFLRLENEHLYNCGQFRATRDIFITRLDPQEERFLESVMDNTE 634
            :....|:.|||.|||.|||||||.|||:|||.|||.|..||..::..:..:||..:
  Fly   575 VTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILRLMDEAD 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 75/161 (47%)
SPX 3..163 CDD:281146 74/160 (46%)
EXS 267..601 CDD:281164 140/340 (41%)
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 75/161 (47%)
SPX 3..158 CDD:281146 75/162 (46%)
EXS 258..597 CDD:281164 141/343 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152179
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10783
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.