DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and SPAC1D4.05c

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_593018.1 Gene:SPAC1D4.05c PomBaseID:SPAC1D4.05c Length:387 Species:Schizosaccharomyces pombe

Alignment Length:381 Identity:88/382 (23%)
Similarity:156/382 (41%) Gaps:108/382 (28%)


  Fly   254 VDTSPEFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSF 318
            ::.:.||:...||    |:. ...|:|.|..:.:....|   .::|..:.:..||.         
pombe    74 LEENTEFKANLVS----PVD-FHAGYCFAAILSISWATG---FILFLKKTQGDIGG--------- 121

  Fly   319 FGYMCTLSILLYLLHKEFFIEDPIYIPLVQV--AFVVVLFLNPFRILFYSGRIWLLTVMGRILLS 381
                      ||        ..||| ||:.|  ||::::|..|:|  :.|.:..|...:.|:.| 
pombe   122 ----------LY--------SHPIY-PLLWVITAFILIVFPFPWR--YRSSQRGLRKSIIRVFL- 164

  Fly   382 PFFFVNF----ADFWVADQWTSLVVTIVDHY--------YLVRFYVR--------YFLDRSDAFE 426
             ||..:|    .||.|::.:||....:.|.|        ::.:|.:|        :|:..:.|:.
pombe   165 -FFQADFRSPYKDFIVSEIFTSYAKALGDFYIFGCVLQGHISKFTLRPDLKCDGTFFVPLAMAYP 228

  Fly   427 FEPDYAVAVIRCLPAWFRFAQSLRR--FRDSGSKSTDYLINALKYFLFIAEVVFSTI------QM 483
            |    .||:::||    .:..|.|:  |:.:       |::|||:...:..:..|.|      :.
pombe   229 F----IVAILQCL----HYGLSRRKHTFKIN-------LLSALKHATALPVIYLSAIIHAKQTKF 278

  Fly   484 ETIAHYTDLFESPWTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLR--DNLVYPRWFYY 546
            ...:.:..||     |.:|...::||.||..||:.:|      |.....|.:  ::..:|.:.|.
pombe   279 TLTSGHGYLF-----WLWILSALLSSAYTFLWDVFID------WRIRFPFHKSINHKRFPMFIYA 332

  Fly   547 FVIVENTLLRCVWILEF-ALVHQELIAPYNGKSLICFS----EIARRFFWNFLRLE 597
            .....|.:||..|.::. ..:||     ::...:..||    ||.|||.|.|..|:
pombe   333 IGCFINFILRVTWSMKLHPRLHQ-----FHEYEMGIFSFEMLEILRRFLWLFFHLD 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898
SPX 3..163 CDD:281146
EXS 267..601 CDD:281164 84/369 (23%)
SPAC1D4.05cNP_593018.1 COG5409 2..387 CDD:227696 88/382 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.