DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and SPAC14C4.11

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_594916.1 Gene:SPAC14C4.11 / 2541428 PomBaseID:SPAC14C4.11 Length:734 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:54/199 - (27%)
Similarity:81/199 - (40%) Gaps:62/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |:|..:::..:...||.:||||.|||.:::.. |:|||           :..|.|..|.:....:
pombe     1 MRFSDSIEAGIYEPWRDKYMNYPELKHLLKTE-EEAPS-----------WGENDESKFVSVMDAQ 53

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLR 130
            |.||..|  |.:.     |..||..:|..:             |..|.|::|:|    |||.|  
pombe    54 LEKVYAF--HLEI-----LKELNESVDWVK-------------SKVSASQEPDG----PPISK-- 92

  Fly   131 LAMSEFYLSLI-----------MLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLA 184
                |..:.|:           .|:.|..||:|.|.||.||:||         .|..|.|:....
pombe    93 ----EEAIKLLERLDSCTETVKKLEKYTRLNLTGFFKIVKKHDK---------LYPGYSLRPVFQ 144

  Fly   185 ITLQ 188
            :.|:
pombe   145 VRLR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 47/171 (27%)
SPX 3..163 CDD:281146 47/170 (28%)
EXS 267..601 CDD:281164
SPAC14C4.11NP_594916.1 COG5036 1..497 CDD:227369 54/199 (27%)
SPX_VTC2_like 2..132 CDD:269901 47/171 (27%)
PolyPPase_VTC2-3_like 195..490 CDD:143630
VTC1 592..718 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.