DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10481 and xpr1a

Sequence 1:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001232029.1 Gene:xpr1a ZFINID:ZDB-GENE-060503-362 Length:692 Species:Danio rerio

Alignment Length:680 Identity:263/681 (39%)
Similarity:366/681 (54%) Gaps:60/681 (9%)


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |||.:.|...:.||||.||:.|...|:|:..|.::|||......|....||..|||.||.:|..|
Zfish     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSLEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQ----LDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPI 126
            |:|:|.|::.|.|||.|:.|||..:    ||.:|....| ...:.|.:....|.:...|.:  .|
Zfish    66 LSKINTFYSEKLAEAQRRFATLQNELQTSLDAQRESNAP-ALRSRRKTVLPLSNKERNKHR--NI 127

  Fly   127 KKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDR 191
            |.|:||.||||||||:|||||.||.|.||||.||:||.|.:..|..|...:|..:......::.:
Zfish   128 KDLQLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILDTPRGADWRVAHVEVAPFYTCKKITQ 192

  Fly   192 MISTTENMYTDYLANGDRSEAMAKLRVPPLG--HPTPPVHVFSAGLFLGLFLVSAILCFISYFAV 254
            :||.||.:.|..|..|||.:||.:|||||||  .|.|....|..||:.|:|:|.|: .|:...|.
Zfish   193 LISETEALVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFIVLAV-AFVLTGAF 256

  Fly   255 DTSPEFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFF 319
            ....:..:..|.::||....|.|.|.|.||...:...|||.|||||:..||.:......||:.|.
Zfish   257 FVRKQNIWPLVRIYRGGFLLVQFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFL 321

  Fly   320 GYMCTLSILLYLLHKEFFIEDPIYI-PLVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSPF 383
            |.:..||||..|.....::  |:.. ||:...|:::..:|||:..:|..|.||:.::.|:..:||
Zfish   322 GVLWCLSILSCLFADYTWL--PMQANPLILYGFMLLFLINPFKTAYYKSRFWLIKLLFRVFTAPF 384

  Fly   384 FFVNFADFWVADQWTSLVVTIVDHYYLVRFY--------------VRYFLDRSDAFEFEPDYAV- 433
            ..|.|||||:|||..|||:.:.|..|||.:|              .::..:|.::|    .|.| 
Zfish   385 HRVEFADFWLADQLNSLVIVLSDLEYLVCYYSMELQWGERNGLLPAKFGDERCNSF----SYGVR 445

  Fly   434 AVIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPWT 498
            |:|.|||||.||.|.|||:||: .::..:|:||.||......|.|:.:..   .|..........
Zfish   446 AIIHCLPAWLRFVQCLRRYRDT-RRAFPHLVNAGKYSTTFFVVTFAALYR---THKDQNHADSEV 506

  Fly   499 WAYITI--CIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYP-RWFYYFVIVENTLLRCVWI 560
            :.|:.:  .||||:||:.|||.||:|||....|||.|||:.:||| :.:||..|:|:.|||..|.
Zfish   507 FFYMLVLSSIVSSLYTLIWDLKMDWGLFDRNAGENTFLREEIVYPHKAYYYCAIIEDVLLRFAWT 571

  Fly   561 LEFALVHQ-----------ELIAPYNGKSLICFSEIARRFFWNFLRLENEHLYNCGQFRATRDIF 614
            |:.:|...           .::||.         |:.|||.|||.|||||||.|||:|||.|||.
Zfish   572 LQISLTSMTRIPSIEDIVVTILAPL---------EVFRRFVWNFFRLENEHLNNCGEFRAVRDIS 627

  Fly   615 ITRLDPQEERFLESVMDNTEDLGREKLNKK 644
            :..|:..::..||.:||. ||..|.:..||
Zfish   628 VAPLNADDQTLLEQMMDQ-EDGVRNRQGKK 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 73/165 (44%)
SPX 3..163 CDD:281146 72/164 (44%)
EXS 267..601 CDD:281164 134/364 (37%)
xpr1aNP_001232029.1 SPX_XPR1_like 2..164 CDD:269898 73/165 (44%)
SPX 3..169 CDD:281146 74/169 (44%)
EXS 284..614 CDD:281164 128/349 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.