DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and THAP7

DIOPT Version :10

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_085050.2 Gene:THAP7 / 80764 HGNCID:23190 Length:309 Species:Homo sapiens


Alignment Length:384 Identity:79/384 - (20%)
Similarity:117/384 - (30%) Gaps:132/384 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  3079 HCAVEGC--EVTVEDVGGTIKLHKFPASSEAAR-KWMHNTQ-VDMDEKFWW----RY-RICSYHF 3134
            ||:..||  ..|.|.....|..|:.|......| .|:.|.| :|...:..|    .| ..||.||
Human     4 HCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHF 68

  Fly  3135 EQECFQSA------RIKKGAMPTLLLGPKRPDKVYDNEFALQETEELILPEDLEFEDTKKPKREV 3193
            |::||:..      |:|:||:||:                              ||...|.:|  
Human    69 EEDCFELVGISGYHRLKEGAVPTI------------------------------FESFSKLRR-- 101

  Fly  3194 IKLCLPTPAPPRKSSKFCQIEGCMNHLTTENITLHKFPHSEDMCLKWQHNTQVPFDPFHRWRYRI 3258
                                        |.....|.:|..                |....|.|.
Human   102 ----------------------------TTKTKGHSYPPG----------------PAEVSRLRR 122

  Fly  3259 CSVHFHPVCLLNMRLVHGSVPTLKLGSKSPTELFDNDFEAINL----------RLDKKLGTDHST 3313
            |          ..|...|..||.......|.::.....|..:.          ||:..|.:..|.
Human   123 C----------RKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSD 177

  Fly  3314 V------QIKEEDEDSMPSLEPEPQLHEDQEVEDSEAM-QIP-------LNQTNWKGQLRLLVKQ 3364
            :      |..|....:.||.|.:|...|.:.|..|..| ::|       .|:.:::....||.|:
Human   178 LLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLWKR 242

  Fly  3365 EKVTYNQVKSGYDKCSLSHCQRQRSKHGVHIYKFPKSKLQQERWMHNLRIRYDERRPWK 3423
                  :.::..|....:..|.|..|......:...:|||||| ....|.:.|.|:..|
Human   243 ------RAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQER-AREKRAQADARQTLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933 22/69 (32%)
DM3 3227..3284 CDD:128933 10/56 (18%)
DM3 3396..3452 CDD:128933 10/28 (36%)
DM3 3544..3601 CDD:128933
THAP 3622..>3673 CDD:461662
DM3 3690..3748 CDD:128933
THAP7NP_085050.2 THAP 4..93 CDD:214951 29/118 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..209 11/50 (22%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 229..232 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.