DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and THAP1

DIOPT Version :10

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_060575.1 Gene:THAP1 / 55145 HGNCID:20856 Length:213 Species:Homo sapiens


Alignment Length:166 Identity:47/166 - (28%)
Similarity:67/166 - (40%) Gaps:41/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  3080 CAVEGCEVTVEDVGGTIKLHKFPASS-------EAA--RKWMHNTQVDMDEKFWWRYRICSYHFE 3135
            |:..||: ...|....:..||||.:.       |||  ||....|:..         .|||.||.
Human     5 CSAYGCK-NRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYS---------SICSEHFT 59

  Fly  3136 QECFQ----SARIKKGAMPTLLLGPKRPDKVYDNEFALQETEELILPEDLEFEDTKKPKREV--- 3193
            .:||:    :..:|:.|:||:.|..:..||..|    |.|.:|.:.|..|     ..|..:|   
Human    60 PDCFKRECNNKLLKENAVPTIFLCTEPHDKKED----LLEPQEQLPPPPL-----PPPVSQVDAA 115

  Fly  3194 IKLCLPTPAPPRKSSKFCQIEGCMNHLTTENITLHK 3229
            |.|.:|....|...|.||      :|..|...|:|:
Human   116 IGLLMPPLQTPVNLSVFC------DHNYTVEDTMHQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933 21/69 (30%)
DM3 3227..3284 CDD:128933 1/3 (33%)
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3622..>3673 CDD:461662
DM3 3690..3748 CDD:128933
THAP1NP_060575.1 THAP 4..82 CDD:214951 25/86 (29%)
HCFC1-binding motif (HBM) 134..137 1/2 (50%)
Involved in homodimer formation. /evidence=ECO:0000269|PubMed:28299530 139..185 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.