DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NFYB

DIOPT Version :8

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_005268965.1 Gene:NFYB / 4801 HGNCID:7805 Length:208 Species:Homo sapiens

Alignment Length:131 Identity:70/132 (53%)
Similarity:92/132 (70%) Gaps:12/132 (9%)


  Fly     5 EDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDAREC 69
            :|::..:||    .||.....:|        .||||.:|||.|:.:|||..:||.|||||||:||
Human    34 DDTEDSMND----HEDTNGSKES--------FREQDIYLPIANVARIMKNAIPQTGKIAKDAKEC 86

  Fly    70 IQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRN 134
            :|||||||||||:|||.||...|.|||:||:|:|.|.|.||||:|||||.:||||:||:.|.::.
Human    87 VQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG 151

  Fly   135 L 135
            :
Human   152 I 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 42/63 (67%)
NFYBXP_005268965.1 CBFD_NFYB_HMF 60..123 CDD:279185 43/63 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116238206
eggNOG 1 0.900 E2759_KOG0869
Hieranoid 1 1.000
Homologene 1 1.000 H38149
Inparanoid 1 1.050 142 1.000 Inparanoid score I4396
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1529111at2759
OrthoFinder 1 1.000 FOG0000993
OrthoInspector 1 1.000 T1073321
orthoMCL 1 0.900 OOG5_127594
Panther 1 1.100 LDO PTHR11064
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R548
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.