DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NFYB

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001401447.1 Gene:NFYB / 4801 HGNCID:7805 Length:208 Species:Homo sapiens


Alignment Length:131 Identity:70/131 - (53%)
Similarity:92/131 - (70%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDAREC 69
            :|::..:||    .||.....:|        .||||.:|||.|:.:|||..:||.|||||||:||
Human    34 DDTEDSMND----HEDTNGSKES--------FREQDIYLPIANVARIMKNAIPQTGKIAKDAKEC 86

  Fly    70 IQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRN 134
            :|||||||||||:|||.||...|.|||:||:|:|.|.|.||||:|||||.:||||:||:.|.::.
Human    87 VQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG 151

  Fly   135 L 135
            :
Human   152 I 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 61/89 (69%)
NFYBNP_001401447.1 HFD_NFYB 53..143 CDD:467032 61/89 (69%)

Return to query results.
Submit another query.