DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NFYB

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_005268965.1 Gene:NFYB / 4801 HGNCID:7805 Length:208 Species:Homo sapiens


Alignment Length:131 Identity:70/131 - (53%)
Similarity:92/131 - (70%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDAREC 69
            :|::..:||    .||.....:|        .||||.:|||.|:.:|||..:||.|||||||:||
Human    34 DDTEDSMND----HEDTNGSKES--------FREQDIYLPIANVARIMKNAIPQTGKIAKDAKEC 86

  Fly    70 IQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRN 134
            :|||||||||||:|||.||...|.|||:||:|:|.|.|.||||:|||||.:||||:||:.|.::.
Human    87 VQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG 151

  Fly   135 L 135
            :
Human   152 I 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 42/62 (68%)
NFYBXP_005268965.1 CBFD_NFYB_HMF 58..123 CDD:395650 42/64 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148225
Domainoid 1 1.000 94 1.000 Domainoid score I7523
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 1 1.050 142 1.000 Inparanoid score I4477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - oto91853
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.