DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and T26A5.8

DIOPT Version :8

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_498421.1 Gene:T26A5.8 / 175921 WormBaseID:WBGene00020823 Length:137 Species:Caenorhabditis elegans

Alignment Length:87 Identity:22/88 (25%)
Similarity:41/88 (47%) Gaps:7/88 (8%)


  Fly    23 SGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIE 87
            |.:|.|:.|.    |.....:|...:.::||   ..|...:||||:.|....:.|:..:|..:.:
 Worm     2 SSNDVDQNDD----RIAQMMMPAAIVTRLMK---EDNISASKDARDVIARAAAVFLINLSDVSAQ 59

  Fly    88 RSVAENRKTVNGDDLLVAFSNL 109
            .:..:..||::|||::.....|
 Worm    60 SARDQKHKTISGDDVVKGLREL 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 16/63 (25%)
T26A5.8NP_498421.1 H4 18..74 CDD:304892 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.