DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and Klf5

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_445846.2 Gene:Klf5 RGDID:621446 Length:443 Species:Rattus norvegicus

Alignment Length:561 Identity:126/562 (22%)
Similarity:202/562 (36%) Gaps:188/562 (33%)


  Fly   210 PVPEESNCYVQIKEEPLNAEEADRMLLEDNPPLNVKLEPQDEEMPDVSRIKEEQSNGSVWTAIHT 274
            |||:..    ..::||:.| :...:|...||..:..|.|.|:       :|....        |.
  Rat    14 PVPQPP----AAQDEPVFA-QLKPVLGAANPVRDAALFPGDD-------LKHAHH--------HP 58

  Fly   275 PLRNKL---RLPA--LATTKNQM--HLKPGVKRNGLLTSNVESLNKKSNHSVI----SDDANIPI 328
            |.....   |||.  |..|:.:|  :|.|.:....:::.:.:  .::.:.||:    :|...:|.
  Rat    59 PAPPPAAGPRLPCEELVQTRCEMEKYLTPQLPPVPIISEHKK--YRRDSASVVDQFFTDTEGLPY 121

  Fly   329 S-NQE---PSNSSIAANILKVLPSNCMVIKLPPNTKIFKTPGQAPAAPKDSPTVTLSGTENSTNF 389
            | |..   |..:.:...:.|........||..|.| ||....::.|.|..:||..|         
  Rat   122 SINMNVFLPDITHLRTGLYKSQRPCVTQIKTEPVT-IFSHQSESTAPPPPAPTQAL--------- 176

  Fly   390 IKIPKTISISTVGSMGNPHASAKTVQPTQTHSRSSCFLVDSFNNSKSRPESMKIINEFRNQIRSI 454
               |:..||         .:|.:|..|                         ::.|.|      |
  Rat   177 ---PEFTSI---------FSSHQTTAP-------------------------EVNNIF------I 198

  Fly   455 EKTLPLPG-------------TVLQSSKVTMDEST--SSPMDAPKPVELMLN--PSALMVARELE 502
            ::.||:|.             .:|.:..:.|..||  ::.||........||  |||:.      
  Rat   199 KQELPIPDLHLSVPSQQGHLYQLLNTPDLDMPSSTNQTAVMDTLNVSMAGLNSHPSAVP------ 257

  Fly   503 IQYPLYRFMWTCPLCQRMFEKHCAFRAHLTNKHDLTDEKCNVLKVVLMPSKILSQDSANAATQRV 567
             |..:.:|....|         |.:                     .|||:.|.|       |..
  Rat   258 -QTSMKQFQGMPP---------CTY---------------------TMPSQFLPQ-------QAT 284

  Fly   568 HVPLNP---------------QTPVPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKGLSP 617
            :.|.:|               |...|||....|:...|.:...:.|.|        :|||   ||
  Rat   285 YFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPAT--------LPVN---SP 338

  Fly   618 TSINIEKPKVSKKP----KKNQSFQC--TECLKVFTTFGALRIHKSIHTGELPYQCSY--CDKRF 674
               ||:..:.:::.    :|.:...|  ..|.||:|....|:.|...||||.||:|::  ||.||
  Rat   339 ---NIQPVRYNRRSNPDLEKRRIHFCDYDGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRF 400

  Fly   675 RTPGQVRVHHRRHTGEKPFKCKICSLDFTHRETLISHLSRH 715
            ....::..|:|:|||.|||:|.:|:..|:..:.|..|:.||
  Rat   401 ARSDELTRHYRKHTGAKPFQCVVCNRSFSRSDHLALHMKRH 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 7/22 (32%)
zf-H2C2_2 651..676 CDD:290200 13/27 (48%)
C2H2 Zn finger 667..687 CDD:275368 7/22 (32%)
zf-H2C2_2 680..704 CDD:290200 11/24 (46%)
C2H2 Zn finger 695..715 CDD:275368 6/20 (30%)
C2H2 Zn finger 723..742 CDD:275368
Klf5NP_445846.2 COG5048 345..>419 CDD:227381 26/74 (35%)
C2H2 Zn finger 361..383 CDD:275368 7/22 (32%)
zf-H2C2_2 375..>392 CDD:290200 9/17 (53%)
C2H2 Zn finger 391..413 CDD:275368 7/22 (32%)
zf-H2C2_2 405..430 CDD:290200 11/25 (44%)
C2H2 Zn finger 421..441 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BRQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.